PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018809P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 720aa    MW: 78602.6 Da    PI: 6.0971
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018809P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-194398156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q++++e++F+++++p+ ++r+eL+++l+L+  qVk+WFqN+R+++k
  MELO3C018809P1 43 KKRYHRHTQHQIQQMEAFFKECPHPDDKQRKELSRELNLEPLQVKFWFQNKRTQMK 98
                    688999***********************************************999 PP

2START222.81e-692364561206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++elv++a+ +ep+W++ +     ++n++e++++f+++ +     +s ea+ra++vv+m++  lve l+d++ qW++ ++    +a+tl
  MELO3C018809P1 236 ELAVAAMEELVRMAQMGEPLWMTGVdgstNELNEEEYVRSFPRGIGpkpsgFSCEASRATAVVIMNHISLVEMLMDVN-QWSTIFTgivsRAMTL 329
                     57899********************999999************999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m++elq++splvp R+++fvRy++q+g+g+w++vdvS+d+ ++ p      R++++pSg+li++++ng+skvtwvehv
  MELO3C018809P1 330 EVLSTGvagnynGALQVMTSELQVPSPLVPtRESYFVRYCKQHGEGTWAVVDVSLDNLRPAPA----LRCRRRPSGCLIQEMPNGYSKVTWVEHV 420
                     ************************************************************995....**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+l+++lv+sg+a+gak+w atl+rqce+
  MELO3C018809P1 421 EVDDRGVHSLYNQLVSSGHAFGAKRWIATLDRQCER 456
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-212198IPR009057Homeodomain-like
SuperFamilySSF466895.01E-192699IPR009057Homeodomain-like
PROSITE profilePS5007116.53640100IPR001356Homeobox domain
SMARTSM003892.2E-1841104IPR001356Homeobox domain
PfamPF000462.7E-174398IPR001356Homeobox domain
CDDcd000867.12E-1943101No hitNo description
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PROSITE profilePS5084845.676227459IPR002913START domain
SuperFamilySSF559612.88E-34229458No hitNo description
CDDcd088752.23E-129231455No hitNo description
SMARTSM002344.7E-65236456IPR002913START domain
PfamPF018522.8E-59237456IPR002913START domain
Gene3DG3DSA:3.30.530.201.7E-5289438IPR023393START-like domain
SuperFamilySSF559611.1E-23476711No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MGENEYGRMR ETEEFESGTK SSSENHEVGS GDDQLNNQRP NKKKRYHRHT QHQIQQMEAF  60
FKECPHPDDK QRKELSRELN LEPLQVKFWF QNKRTQMKTH HERHENTQLR TENEKLRADN  120
MRYREALSNA TCPNCGGPTA IGEMSFDEHH LRLENARLRE EIDRISAIAA KYVGKPVSNY  180
PLLSTPIPSR PLEIGMGSYG GHDLGLGPGG GDMFGAADLL RTISAPSEAD KPVIIELAVA  240
AMEELVRMAQ MGEPLWMTGV DGSTNELNEE EYVRSFPRGI GPKPSGFSCE ASRATAVVIM  300
NHISLVEMLM DVNQWSTIFT GIVSRAMTLE VLSTGVAGNY NGALQVMTSE LQVPSPLVPT  360
RESYFVRYCK QHGEGTWAVV DVSLDNLRPA PALRCRRRPS GCLIQEMPNG YSKVTWVEHV  420
EVDDRGVHSL YNQLVSSGHA FGAKRWIATL DRQCERLASA MATSIIPNGD AGVITNQEGR  480
KSMLKLAERM VMSFCGGVSA STTHTWTTLS GTGADDVRVM TRKSVDDPGR PSGIVLSAAT  540
SFWLPLPPNR VFHFLRDENS RNEWDILSNG GVVQEMAHIA NGRDTGNCVS LLRVNSANSS  600
QSNMLILQES STDQTASFVI YAPVDIVSIN VVLNGGDPDY VALLPSGFAI LPDGSTASSG  660
GANGAGEHGS GGSLLTVAFQ ILVDSVPTAK LSLGSVATVN NLIACTVERI KASLSCDNP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455423.10.0PREDICTED: homeobox-leucine zipper protein HDG2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A1S3C1110.0A0A1S3C111_CUCME; homeobox-leucine zipper protein HDG2
STRINGXP_008455423.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2