PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018793P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GeBP
Protein Properties Length: 409aa    MW: 46692 Da    PI: 4.9984
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018793P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573125.32.8e-39182276397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     ++rlwse+Dei++LqG+idf+  +g++p+ d+++f +f+++++s++vsk+ql++K+rrLKkK+k++++k ++g++p+f k+h++k+f lskkiWg
  MELO3C018793P1 182 INRLWSEDDEISILQGMIDFQLAKGSDPYTDMNQFLDFIRENLSVDVSKNQLIDKVRRLKKKYKNNSEKGRNGDDPVFLKQHEHKSFVLSKKIWG 276
                     68********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-33183276IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MAPKRLVEDL PSAHAFSDAE EESDFETHED PEIDNLMNNS EDENEEHNQE DDDEEEEEEE  60
HDEEQEHEQE IRSPIISKHE NSLEKDSGFV SDSDSEKTQS SPSASAFTIK PILRKLATDS  120
SKPKKSSHKS SIDCATTAKP VCSGSKRLIE NHFQGNDPNK KIKRAMNGED IEEVKRVSGS  180
GINRLWSEDD EISILQGMID FQLAKGSDPY TDMNQFLDFI RENLSVDVSK NQLIDKVRRL  240
KKKYKNNSEK GRNGDDPVFL KQHEHKSFVL SKKIWGNEAK KKPRKQSVKA SNSVSISSPR  300
VDVEAGKLKE IINYNNVESK ILPEEFLSEY PWLKASFMVE NDKFRSEGLM RLVRERMPSI  360
GSEKAKELDD KWRKLGESEL ELYVKKVDLV REQCKLILDS MGKAKRSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455395.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A1S3C0T60.0A0A1S3C0T6_CUCME; mediator-associated protein 1-like
STRINGXP_008455395.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.18e-30DNA-binding storekeeper protein-related transcriptional regulator