PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018686P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 321aa    MW: 35379.1 Da    PI: 7.0259
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018686P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702212.31.1e-65962443154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                      g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpaakrrerqqq ++  +++ +++++a++ ++ +l   k+   ++  l++ + +
  MELO3C018686P1  96 GGGMNCQDCGNQAKKDCSHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQRHQIFQNHRRQQSQANQSDQTTL---KRYGENQPLLATPTVT 187
                     5789***************************************************999998887766666666655...3333444445555556 PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     + le++++P+e +s+a frcv+vs++d+ ee+laYqt+v+igGh+fkGiLyd+G+e+
  MELO3C018686P1 188 SGLEVAHFPAEFNSPANFRCVKVSAIDNVEEQLAYQTSVNIGGHMFKGILYDHGPET 244
                     68999**************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-6298243IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-26100142IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.2E-24194242IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MRGLLYLGGK QEEDEEEILR SGREQQLFLY SSTNNHNNEE IYSKGLEIWP QQNVENYISF  60
GVVGPTRKNL IINASDHELV SRLGFSMMRG GGGGGGGGMN CQDCGNQAKK DCSHLRCRTC  120
CKSRGFQCQT HVKSTWVPAA KRRERQQQRH QIFQNHRRQQ SQANQSDQTT LKRYGENQPL  180
LATPTVTSGL EVAHFPAEFN SPANFRCVKV SAIDNVEEQL AYQTSVNIGG HMFKGILYDH  240
GPETSQNMSI DIGGESSSYC HGGEDDSQPL DLVIGASNGS GRVSQSSSSA PFVESSLYPI  300
PINNTYNNNT GTQFFPSTRA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455259.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA0A1S3C0M50.0A0A1S3C0M5_CUCME; protein SHI RELATED SEQUENCE 1
STRINGXP_008455259.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.22e-63SHI-related sequence 7