PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017638P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 159aa    MW: 18136.6 Da    PI: 10.5675
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017638P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.43.2e-1373118247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++W++eE+  ++ + k+lG+g+W+ I++   ++Rt+ q+ s+ qky
   MELO3C017638P1  73 KPWSEEEHRTFLIGLKKLGKGDWRGISKNYVTTRTPTQVASHAQKY 118
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.43967123IPR017930Myb domain
SuperFamilySSF466891.12E-1669121IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-1770122IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-1171118IPR009057Homeodomain-like
SMARTSM007171.7E-971121IPR001005SANT/Myb domain
PfamPF002493.0E-1173118IPR001005SANT/Myb domain
CDDcd001672.98E-874119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MENRDESMRK SLSMGNLNLH SSCNNVLDLN NNTTAVNNVT GDNAASADDS GYLSDGLIHN  60
KRRKAAHERK KGKPWSEEEH RTFLIGLKKL GKGDWRGISK NYVTTRTPTQ VASHAQKYFL  120
RKMNANDKKK RRASLFDIPE IKVTILIYSF FFFFFLHL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127131KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132611e-146LN713261.1 Cucumis melo genomic chromosome, chr_7.
GenBankLN6818741e-146LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453855.11e-102PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ8S9H75e-32DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KXN04e-78A0A0A0KXN0_CUCSA; Uncharacterized protein
STRINGfgenesh2_kg.8__2146__AT5G61620.18e-52(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138741921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.13e-50MYB_related family protein