PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017549P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 218aa    MW: 25268.6 Da    PI: 6.5381
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017549P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.9e-2056110357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     k++++t+ q++ Le+ F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  MELO3C017549P1  56 KKRKLTAAQVHLLESNFGSEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 110
                     45689************************************************95 PP

2HD-ZIP_I/II117.86.2e-3856146292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     kkr+l++ qv+lLE++F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y+ Lk+ +++++ e++rLe+e  +L+e+l 
  MELO3C017549P1  56 KKRKLTAAQVHLLESNFGSEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKLEEEYSNLKKLHESVVVEKCRLETELLKLKEQLI 146
                     9***************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.76351111IPR001356Homeobox domain
SMARTSM003891.3E-1854115IPR001356Homeobox domain
SuperFamilySSF466892.1E-1855119IPR009057Homeodomain-like
PfamPF000464.3E-1756110IPR001356Homeobox domain
CDDcd000864.26E-1556112No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2158118IPR009057Homeodomain-like
PRINTSPR000311.4E-58291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000311.4E-591107IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MNQQQTEEHQ SVQISQLYNG LYIQMLPQQG NLGESKPRRR RKKNRGSETE ASSGGKKRKL  60
TAAQVHLLES NFGSEHKLES ERKDRLASEL GLDPRQVAVW FQNRRARWKN KKLEEEYSNL  120
KKLHESVVVE KCRLETELLK LKEQLIEVEK EKERVIMGER ADGPLSSSSP SPSMSMEAME  180
MDPISLGEIS PLYEEDVFYY MPENYCIYGM EWPNPYL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14058RKKNRGSETEASSGGKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453727.11e-158PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU702e-63ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A1S3BY521e-157A0A1S3BY52_CUCME; homeobox-leucine zipper protein ATHB-40
STRINGXP_008453727.11e-158(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-47homeobox protein 40
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]