PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017245P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 550aa    MW: 60274.4 Da    PI: 7.7897
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017245P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.6e-42174250278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  MELO3C017245P1 174 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 250
                     **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33168235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.83E-39172251IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MESWSYVSEG KGCMSDEMNS PTSSLARNKD SLLGWEFKHP CSFSSTMLPT SQQVDNQGFG  60
ELVFPEMIGK QLPDNSVCDI LSSKVVGGRF LNPAMNSSIA FLGEDESTSK LSSSIVDSSS  120
RDLFIDLKLG RFADQRDIHG YKFFKGAPIL SSSESSMPSK RVRASGLNSQ TYFCQVYGCN  180
KDLSSCKDYH KRHKVCEVHS KTAKVIVNGI EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG  240
HNERRRKPQV AINSGRTGRF LQSYNGSRLQ GTALTATSFI CQEILPNGLL HPEKYGTSDW  300
CRTVKIEDKN EYMPLSAVHV PSGHLHSKSL FSPYDIETQV PPFHDNGPNA SATNMFKENS  360
NQYPLSVGGV NSNSRSYFHN PSLGSEYFNV YSAASTDRLS GLSDSGCALS LLSSQTQNSS  420
THSSGIPIGR PLVLLDGQNH YSMSQLSEKL MGVSSQVSVS GVSNKFSSSG LNTSEGCTLG  480
PIPTPETSDA VNFEISNRIF HGSNLADPGE GSPTIDLLQL SSQLQRVEHQ RQAMQVKQES  540
NAFCCLRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291732471084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453304.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_008453305.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_008453306.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A1S3BVC80.0A0A1S3BVC8_CUCME; squamosa promoter-binding-like protein 6
STRINGXP_008453304.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-47SBP family protein