PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017134P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 307aa    MW: 33564.4 Da    PI: 9.7007
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017134P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.8e-14103147347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + +q G+g+W+ I+r + k+Rt+ q+ s+ qky
   MELO3C017134P1 103 PWTEEEHKLFLIGLQQVGKGDWRGISRNFVKTRTPTQVASHAQKY 147
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.65396152IPR017930Myb domain
SuperFamilySSF466892.62E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1699150IPR006447Myb domain, plants
SMARTSM007174.7E-9100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-10102147IPR009057Homeodomain-like
PfamPF002498.2E-11103147IPR001005SANT/Myb domain
CDDcd001671.57E-8103148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MRSTSSSVNE SAAAETGGGS PGEIMLFGVR VVVDSMRKSV SLNNLSQYEQ PHDATDVIAN  60
DNYKNDLVSV NNKDDVAAGY ASADDAVPNA RGNRERERKR GVPWTEEEHK LFLIGLQQVG  120
KGDWRGISRN FVKTRTPTQV ASHAQKYFLR RSNLNRRRRR SSLFDITTDT VTAAPMVEEP  180
LQRKEIPSQS HSFTPSTLPE ISKNKAIPII QTLPVSFGPT PLATPIKNLM ENCGPREVNT  240
QNDGSLKLAL SDSIFSSNQI RHESSSAAAL SLRLSLTPDQ RETSSRHSTF QSIPSFNNGD  300
GIISAA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00236DAPTransfer from AT1G74840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453152.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B02e-67MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0A0LUD40.0A0A0A0LUD4_CUCSA; Uncharacterized protein
STRINGGLYMA05G01640.14e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.25e-62MYB_related family protein