PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016975P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARR-B
Protein Properties Length: 690aa    MW: 76278.5 Da    PI: 6.5079
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016975P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like911e-28197250155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv+av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  MELO3C016975P1 197 KPRVVWSVELHRKFVNAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 250
                     79*******************.********************************8 PP

2Response_reg78.22.8e-26201281109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ + +l+++l++ +y +v+++ ++  al+ll+e++  +D+++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + +  G
  MELO3C016975P1  20 VLAVDDDPTCLLILETLLRRCQY-HVTTTNQAVMALKLLRENKnkFDVVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKGITHG 112
                     799********************.***************888888*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  MELO3C016975P1 113 ACDYLLKPVRIEELKN 128
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.7E-1661689IPR017053Response regulator B-type, plant
SuperFamilySSF521726.4E-3616142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.8E-4217156No hitNo description
SMARTSM004482.5E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.07219134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.9E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.02E-2721134No hitNo description
PROSITE profilePS5129412.057194253IPR017930Myb domain
SuperFamilySSF466897.53E-20194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-30195255IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-26197250IPR006447Myb domain, plants
PfamPF002495.2E-7199249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MTVEPRLEDP VDQFPTGMRV LAVDDDPTCL LILETLLRRC QYHVTTTNQA VMALKLLREN  60
KNKFDVVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DPKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVIRRKKFD PKDRMNSGNQ DRPDSENGEE SADLNGKFNK KRKDQNYNED  180
DDQDYGQDND DSSTQKKPRV VWSVELHRKF VNAVNQLGID KAVPKKILDL MNVEKLTREN  240
VASHLQKYRL YLKRISCVAN QQANMVTALS SADPSYLRIG SLGGIGNFHS LTGPPQFPNT  300
SYRSIPTTGM FGRLNTPACM GMHGLSSPGT VQLGNLSNSS NDQSTFHPIV LSGNRSGNIF  360
RGMPEPSELD QLQHVKHGTH VDNLSSAFDE RTVFPASIGL PNGNMSSSTL SNPLLGLTND  420
SSIPEVQHHE VNGGRKFGTQ SSIAVVSSNS DSSRPSLDNV RCTGDNWSNA VHSSRVHLNT  480
IPSGNLSNVA TSYHGQLRDN TTSALHIGNC LSDISSITSL STQSHESRID SQRQAATTSN  540
RFDQMISKVP VQDWNDHKED AYYHTTMACS SSNSLIPVNG AAETLSKRLE NPNAIFSGSK  600
DFNVTAQANV LDHAMVEHDR LKKSTMETSL MLKQGYLYDH QQKMQSRFSS SNCGSLEDIA  660
CAMMKQEQDD GKLLEGEFGC DNYPIGTCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-25193256164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452870.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A1S3BUB40.0A0A1S3BUB4_CUCME; Two-component response regulator
STRINGXP_008452870.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-135response regulator 12