PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016045P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HB-other
Protein Properties Length: 316aa    MW: 34809.1 Da    PI: 6.1418
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016045P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.61.5e-0669125157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ ++++F  +  +s++e +e+++  g++ +qV+ +F  +R + +k
  MELO3C016045P1  69 KRPRDLLNPKAVKYMQTVFSIKDALSKKESREISALFGVKVTQVRDFFNSQRSRVRK 125
                     799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.42666126IPR001356Homeobox domain
SuperFamilySSF466892.87E-668128IPR009057Homeodomain-like
SMARTSM003898.7E-468130IPR001356Homeobox domain
CDDcd000861.07E-469125No hitNo description
Gene3DG3DSA:1.10.10.608.7E-669137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEVLKDDFSN LEIGTSFDSF QKFLDSQKDL FRSQVDQLQS IVVTQCKLTG VNPLSQEMAA  60
GALSIAIGKR PRDLLNPKAV KYMQTVFSIK DALSKKESRE ISALFGVKVT QVRDFFNSQR  120
SRVRKLVRVS REKSIQSNSC KQLEVGGIVT NNDPSIPIDA VPLNTDAVVP LNADAPMPLN  180
SEAPVPLNFD TPVPLNTIEP SNVDNGPSCS TQDSELSGID GVDKHFVQTI FSMMQKEETF  240
SGQVKLMEWI LQIQNSSVLC WFLTKGGAII LATWLSQAAA EEQTSLLYVI LEVFCHLPLH  300
KALPVHISAI LQKKC*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451616.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-107LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A1S3BRZ10.0A0A1S3BRZ1_CUCME; homeobox protein LUMINIDEPENDENS
STRINGXP_008451616.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-100HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]