PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C015453P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HRT-like
Protein Properties Length: 478aa    MW: 53120.5 Da    PI: 9.956
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C015453P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like51.22.1e-16268297231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv +++G vC+++Pv+gRKRC+eHKGm+i
  MELO3C015453P1 268 CGVVIGHGEVCRKPPVEGRKRCAEHKGMKI 297
                     ****************************97 PP

2HRT-like634.2e-20355385131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv l dGs+C+r+Pv+gRKRCeeHKG+Ri
  MELO3C015453P1 355 ICGVVLYDGSPCRRPPVQGRKRCEEHKGKRI 385
                     8*****************************7 PP

3HRT-like54.12.7e-17425455131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv l++G  C+rqPvkgR RC eHKGmR+
  MELO3C015453P1 425 MCGVDLGNGLYCTRQPVKGRVRCGEHKGMRT 455
                     6*****************************5 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MVAELSQIRL KREDCKRTKH DSSFSKWEIL VASSDWEDYS LGKEGAERYR IHNLPKVSGP  60
GLYELGITVS SSGLGREIAK LDADCIVVVY LGEADNVRTR LQHYGRSGSH LGNGYLSVED  120
CKVVPLEKGP SLFQEMFSRG YSIVYRWAPM KNKRDAQMTE AQLLKTFDYA WNTSGNGARR  180
HNDVIKKLED IASQTTKSTF ISRKLLPFRQ KKMGIKIKTS KPIPIVNKPA EDAEERNNFF  240
SRILSFSRSR PRLVDNTNDV NWADSNSCGV VIGHGEVCRK PPVEGRKRCA EHKGMKINGL  300
LKNSSSRLNL QKPVNVGTTI YGEKDFSCSK SEIPNNTEEC SVSNSFTNEG SSLPICGVVL  360
YDGSPCRRPP VQGRKRCEEH KGKRICRSTL VTSKYKQTSP ISKPESTVIA RGTSSELSSS  420
GLERMCGVDL GNGLYCTRQP VKGRVRCGEH KGMRTNKLIL RLATSIKPDV SDTGSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
GenBankLN6818060.0LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450835.10.0PREDICTED: uncharacterized protein LOC103492307
TrEMBLA0A0A0LWE70.0A0A0A0LWE7_CUCSA; Uncharacterized protein
STRINGVIT_11s0016g02440.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-91effector of transcription2