PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014944P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 274aa    MW: 30322.4 Da    PI: 8.6229
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014944P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-18122176256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F++n++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  MELO3C014944P1 122 RKKLRLSKQQSALLEESFKQNSTLNPKQKQGLARQLNLLPRQVEVWFQNRRARTK 176
                     778899***********************************************98 PP

2HD-ZIP_I/II121.25.3e-39122210190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rlsk+q++lLEesF+++++L+p++K+ lar+L+l prqv+vWFqnrRARtk kq+E+d+e Lk+++++l++en+rL+kev+eL+ +
  MELO3C014944P1 122 RKKLRLSKQQSALLEESFKQNSTLNPKQKQGLARQLNLLPRQVEVWFQNRRARTKVKQTEVDCELLKKCCETLTDENRRLQKEVQELK-A 210
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-18112179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-17114181IPR009057Homeodomain-like
PROSITE profilePS5007117.232118178IPR001356Homeobox domain
SMARTSM003893.7E-14120182IPR001356Homeobox domain
CDDcd000868.81E-17122179No hitNo description
PfamPF000461.5E-15122176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PfamPF021831.2E-10178211IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.6E-25178221IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGFDDFSKTG LVLGLGLSEL ADDQRTTLKK KPAPCSSSSL DFEPCVLTLG FSGGGGDPHR  60
KVIDHEGVRH LYRQTSPHSS AVCSSFSGKV KRERDLSSEE VELERVCWRV SDEDDDGCNN  120
TRKKLRLSKQ QSALLEESFK QNSTLNPKQK QGLARQLNLL PRQVEVWFQN RRARTKVKQT  180
EVDCELLKKC CETLTDENRR LQKEVQELKA IKLAKPVYMQ MSGATLTICP SCERVGTGGH  240
GGVADGNSNS KPKFSMPPNP LFYNPFSNPS AAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126TRKKLRL
2170178RRARTKVKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818570.0LN681857.1 Cucumis melo genomic scaffold, anchoredscaffold00023.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450165.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466044e-86HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A1S3BNL60.0A0A1S3BNL6_CUCME; homeobox-leucine zipper protein HAT22-like
STRINGXP_008450165.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-88HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]