PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014426P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 62aa    MW: 7115.16 Da    PI: 9.0387
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014426P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP34.19.5e-112161242
             TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfd 42
                    +++k   sk+ T++g+ d  v l a++a+rf+d+qd+LG++
  MELO3C014426P1 21 TARKYHCSKVFTAKGPLDHDVKLLAHTAIRFYDVQDRLGYK 61
                    6788899********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.532061IPR017887Transcription factor TCP subgroup
PfamPF036349.8E-82261IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MKTNTYDEIV LVQDSHILYS TARKYHCSKV FTAKGPLDHD VKLLAHTAIR FYDVQDRLGY  60
K*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818422e-99LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132592e-99LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022989259.12e-19transcription factor TCP10-like
SwissprotA2WM144e-16PCF5_ORYSI; Transcription factor PCF5
SwissprotQ8LT074e-16PCF5_ORYSJ; Transcription factor PCF5
TrEMBLA0A2R6QXG88e-17A0A2R6QXG8_ACTCH; Transcription factor like
TrEMBLC6TEY27e-17C6TEY2_SOYBN; Uncharacterized protein (Fragment)
STRINGVIT_12s0028g02520.t012e-16(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2494423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31070.12e-18TCP domain protein 10