PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013882P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 389aa    MW: 43106.5 Da    PI: 9.7002
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013882P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70225.73.2e-085084539
          DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathv 39
                    + +C+ CGn a+  C +e C+ CC  +   C  hv
  MELO3C013882P2 50 KPKCRVCGNVARSRCPYESCKSCCARNQNPCYIHV 84
                    568*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-55285IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MAAPSPTLSN NSSDTATTTA GAVAANVAVS PNHLANRTGT PPKTLRGLNK PKCRVCGNVA  60
RSRCPYESCK SCCARNQNPC YIHVLKANAT FPDKTPSSSS PLFDKQSPDL SSSGTSNRVA  120
SLRQLSSNFS QFNNVRLPIR SPKPVTRKDA AAINEWRFSK LREFRERHIE AENEAFDRYM  180
KNVNLLEEVF SMRSMIDDKS LKDGPSVNSG IEANLEEMTP GLKLKLGSTS DNSRKRIRKI  240
VEDGLRKIKI VETTDNVNEV TDHAQADRDA DQMNLNDGCK TIKGSHAKRT RALGDLIEKL  300
NKARNEEDLK SCLAMKHQLF NRLQTTSSQA ESEETDTSKE QQVIKKDLDS RKELGYSLPK  360
LINKTNIDQQ TLNQIDAHFS SLKQIGNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448750.10.0PREDICTED: uncharacterized protein LOC103490821
TrEMBLA0A1S3BKF80.0A0A1S3BKF8_CUCME; uncharacterized protein LOC103490821
STRINGXP_008448750.10.0(Cucumis melo)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.12e-84