PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013409P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 314aa    MW: 35016.6 Da    PI: 10.1198
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013409P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind359.76e-11013131301
       GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalver 77 
                     mdd  ++e  r+k  y++              ++ ++l   +++++ms+iaerda+irernlalsekk+a+a+rd+a+ qrd+al +r+ al+er
  MELO3C013409P1   1 MDDGRQHEngRHKLdYFRgspspwnmvppnhvKEpNALV--MNKKIMSIIAERDAAIRERNLALSEKKDALAARDEALRQRDEALVQRDSALMER 93 
                     666655555788887888999999999876663335666..99**************************************************** PP

       GAGA_bind  78 dnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkk.kkks 171
                     dn+l+al+ ++n+  s+ p g +v ++tk +++l + + p+++++++++++ ++++a+pi+  a+ea ++++ k+ + +k   +k++k + kk +
  MELO3C013409P1  94 DNALAALEIRDNA--SNFPLGGGVQRKTKRLHHLSN-HMPNISETSYGTKDVHITDAFPITVIASEAVKSQQGKRAKDNKLVSSKTSKPPrKKVG 185
                     *********9998..77899999*********9998.78************************99999999999777777766666664413445 PP

       GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                     e+ +++ ++++  ++ +++++ +d++ln vs+D+s++P+P+CsCtG  rqCYkWGnGGWqS+CCtt +S+yPLP   ++r+aR++grKmS+++f+
  MELO3C013409P1 186 EDLNRHAATDG--TKYRTDWDGQDVGLNLVSFDDSSMPAPICSCTGFARQCYKWGNGGWQSSCCTTHMSMYPLPHLENKRHARMGGRKMSGSVFT 278
                     56666666666..68******************************************************************************** PP

       GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     klL++Laa G+dls pvDLkdhWA+HGtn+++tir
  MELO3C013409P1 279 KLLSRLAAAGHDLSVPVDLKDHWARHGTNRYITIR 313
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.4E-971313IPR010409GAGA-binding transcriptional activator
SMARTSM012265.4E-1411313IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MDDGRQHENG RHKLDYFRGS PSPWNMVPPN HVKEPNALVM NKKIMSIIAE RDAAIRERNL  60
ALSEKKDALA ARDEALRQRD EALVQRDSAL MERDNALAAL EIRDNASNFP LGGGVQRKTK  120
RLHHLSNHMP NISETSYGTK DVHITDAFPI TVIASEAVKS QQGKRAKDNK LVSSKTSKPP  180
RKKVGEDLNR HAATDGTKYR TDWDGQDVGL NLVSFDDSSM PAPICSCTGF ARQCYKWGNG  240
GWQSSCCTTH MSMYPLPHLE NKRHARMGGR KMSGSVFTKL LSRLAAAGHD LSVPVDLKDH  300
WARHGTNRYI TIR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817980.0LN681798.1 Cucumis melo genomic scaffold, anchoredscaffold00019.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448032.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448033.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448034.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448035.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448036.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448038.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_008448039.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-130BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A1S3BIS40.0A0A1S3BIS4_CUCME; protein BASIC PENTACYSTEINE4-like
STRINGXP_008448032.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-133basic pentacysteine 4