PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012973P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 351aa    MW: 40462.2 Da    PI: 6.0438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012973P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.25.2e-2272127156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL+ rqVk+WFqNrR++ k
  MELO3C012973P1  72 RKKYHRHTTEQIREMEALFKESPHPDEKQRQQLSKRLGLSPRQVKFWFQNRRTQIK 127
                     7999************************************************9877 PP

2START35.13.1e-12247324468
                     HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCC CS
           START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.........dsgealrasgvvdmvlallveelldd 68 
                      ea +el ++a+a++p+Wv+s+    e++n+de+l++f  +++          ++ea+r++++v+m++ +lv++++d 
  MELO3C012973P1 247 DEAVEELKTMAGAGDPLWVRSVetgrEILNYDEYLKTFRFNNNnsntrnclkTHIEASRETALVFMEPSRLVQSFMDE 324
                     578999********************************8888799*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-2162130IPR009057Homeodomain-like
PROSITE profilePS5007118.13969129IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-2269123IPR009057Homeodomain-like
SMARTSM003896.7E-1971133IPR001356Homeobox domain
PfamPF000462.8E-1972127IPR001356Homeobox domain
CDDcd000864.46E-1872127No hitNo description
PRINTSPR000315.0E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000315.0E-5109125IPR000047Helix-turn-helix motif
PfamPF018523.0E-6247324IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEEVDDGSAG GAARRDNNNN HHDTMTAEVS SENSGAVVRS RSEEEEEEEE EGGGQDDQEN  60
ELVDHGCHVK RRKKYHRHTT EQIREMEALF KESPHPDEKQ RQQLSKRLGL SPRQVKFWFQ  120
NRRTQIKAIQ ERHENTLLKA EMEKLREENK AMREISKKKI GCPNCGTADA TQDDIVFTTT  180
EQLRIKNAKL KAEVEKLRAA LGKYPQAAAS PSTYSSGNEQ ETTNRSCLDF YTGIFGLEKS  240
RIMEKVDEAV EELKTMAGAG DPLWVRSVET GREILNYDEY LKTFRFNNNN SNTRNCLKTH  300
IEASRETALV FMEPSRLVQS FMDEVINYHF STLKCLRLFD KYFVCFFFFF *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0956530.0KM095653.1 Cucumis sativus multicellular trichome development class IV homeodomain-leucine zipper transcription factor (Gl-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447518.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like isoform X1
RefseqXP_016900387.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like isoform X2
SwissprotP466073e-98HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A1S3BII50.0A0A1S3BII5_CUCME; homeobox-leucine zipper protein GLABRA 2-like isoform X1
TrEMBLA0A1S4DWM60.0A0A1S4DWM6_CUCME; homeobox-leucine zipper protein GLABRA 2-like isoform X2
STRINGXP_008447518.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47143352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.11e-100HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]