PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012624P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 161aa    MW: 17234.6 Da    PI: 7.9916
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012624P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.72.7e-45211211101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+dCv+apyfpa++p+kf  vhk+FGasnv+kll++lpe++r+da+ss+vyeA+ar+rdPvyG+vg+i+ lqqq++ l+++la
  MELO3C012624P1  21 PCAACKLLRRRCAHDCVFAPYFPADHPHKFSSVHKVFGASNVSKLLQELPEQQRSDAVSSMVYEANARIRDPVYGCVGTISCLQQQVDALQQQLA 115
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                      ++++l
  MELO3C012624P1 116 ITQAQL 121
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.91820121IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4421118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MASSEMMMSG SCKKGNGAAA PCAACKLLRR RCAHDCVFAP YFPADHPHKF SSVHKVFGAS  60
NVSKLLQELP EQQRSDAVSS MVYEANARIR DPVYGCVGTI SCLQQQVDAL QQQLAITQAQ  120
LVQLKMGQFT TTSQSSSSTD DFLSPPPNIN VAASSSLWSC *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132551e-158LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6818001e-158LN681800.1 Cucumis melo genomic scaffold, anchoredscaffold00017.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447124.11e-117PREDICTED: LOB domain-containing protein 4-like
SwissprotQ8LBW37e-56LBD12_ARATH; LOB domain-containing protein 12
SwissprotQ9SHE96e-56LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0A0K5P44e-90A0A0A0K5P4_CUCSA; Uncharacterized protein
STRINGVIT_19s0027g01120.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-50LOB domain-containing protein 4