PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012064P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 255aa    MW: 29140.6 Da    PI: 4.7335
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012064P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-183991456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++++ +q++ Le+ F+ ++++ +e++ ++A+++gL  rqV vWFqNrRa+ k
  MELO3C012064P1 39 KRRLSVDQVRLLEKNFNDENKLEHERKVQIAEEIGLRPRQVAVWFQNRRARSK 91
                    568999*********************************************98 PP

2HD-ZIP_I/II1185.1e-3838129293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     kkrrls +qv+lLE++F+ e+kLe+erKv++a+e+gl+prqvavWFqnrRAR k+k++E+dye L ++yd+lk++ ++L + ++eL++e+++
  MELO3C012064P1  38 KKRRLSVDQVRLLEKNFNDENKLEHERKVQIAEEIGLRPRQVAVWFQNRRARSKMKRIESDYECLNAEYDKLKSDFDSLLNMNHELKAEVDQ 129
                     9**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.58E-171792IPR009057Homeodomain-like
SMARTSM003897.4E-153697IPR001356Homeobox domain
CDDcd000862.60E-143891No hitNo description
PROSITE profilePS5007116.1153893IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-173891IPR009057Homeodomain-like
PfamPF000462.4E-153991IPR001356Homeobox domain
PRINTSPR000313.2E-56473IPR000047Helix-turn-helix motif
PROSITE patternPS0002706891IPR017970Homeobox, conserved site
PRINTSPR000313.2E-57389IPR000047Helix-turn-helix motif
PfamPF021833.9E-1393133IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDSETTHFLS KPEASSLPCF WVSDSCSSMK GEGTLGGKKR RLSVDQVRLL EKNFNDENKL  60
EHERKVQIAE EIGLRPRQVA VWFQNRRARS KMKRIESDYE CLNAEYDKLK SDFDSLLNMN  120
HELKAEVDQL RAKWAAMEKM KNHFEPVGVE AMVSSVTELE KAKAKTMGEI LYEVQMGSSR  180
HELEGSLSSS KSDCFYSESP TRENQSKSAN FLQDEEDELG YLEKLEDELS ADELMNSFNI  240
LSSAVENQSF CFWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446309.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16
TrEMBLA0A1S3BER70.0A0A1S3BER7_CUCME; homeobox-leucine zipper protein ATHB-16
STRINGXP_008446309.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2461633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-34homeobox protein 6