PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011730P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 174aa    MW: 19126.1 Da    PI: 6.9846
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011730P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.6e-41221211100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r+da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  MELO3C011730P1  22 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPECQRTDAVSSMVYEANARLRDPVYGSAGAICQLQKQVSELQAQLA 116
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MELO3C011730P1 117 KARAE 121
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.53921122IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4122119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSSSPPTSQP SSPPPPPVVL SPCAACKILR RRCVEKCVLA PYFPPTDPLK FTIAHRVFGA  60
SNIIKFLQEL PECQRTDAVS SMVYEANARL RDPVYGSAGA ICQLQKQVSE LQAQLAKARA  120
EVANMQQQQA NLLALICMEM RQSPEPVWQP QLVDTTCFLD DATLSSPWEP LWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132641e-178LN713264.1 Cucumis melo genomic chromosome, chr_10.
GenBankLN6818961e-178LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445860.11e-124PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0KNK91e-123A0A0A0KNK9_CUCSA; Uncharacterized protein
STRINGPOPTR_0008s04350.12e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-62LOB domain-containing protein 1