PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011135P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 97aa    MW: 10508.8 Da    PI: 4.5126
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011135P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.22.2e-1345154101
          DUF260  54 redamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                     r +a+++l++eA++r++dP+yG+vg+i++lq +l+ ++++la++++++
  MELO3C011135P1   4 RGEAAETLYFEAKCRIEDPIYGCVGIISQLQYELHVAETQLAKTRAQI 51 
                     7899***************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.703151IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-11448IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MDVRGEAAET LYFEAKCRIE DPIYGCVGII SQLQYELHVA ETQLAKTRAQ IALLASNLQQ  60
AQHEAQAFAF DDPSSGPICI GLSTPAHWLH SSFSDS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132571e-162LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818231e-162LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445577.15e-66PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-17LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0A0LLX62e-49A0A0A0LLX6_CUCSA; Uncharacterized protein
STRINGBra025217.1-P4e-16(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-17LOB domain-containing protein 24