PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010996P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 339aa    MW: 37767.8 Da    PI: 10.023
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010996P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind391.89.7e-12013381301
       GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllve 88 
                     mdd+g+re  r+k+ +y++a  + + +++   +q+m+++aerda+i+ernlalsekkaa+aerdma+lqrd+a+aern+al+erdn++++l+++e
  MELO3C010996P1   1 MDDSGHREngRHKPdQYKSAqgQWMMQHQpsMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAYLQRDAAIAERNNALLERDNAIATLQYRE 95 
                     9*****999*********6656445545422469************************************************************* PP

       GAGA_bind  89 nsla..salpvgvqvlsgtksidslqq.lse..pqledsavelreeekleal....pieeaaeeakekkkkkkrqrakkpkekkakkkkkkseks 174
                     ns++   ++p+g+q+ +g+k+i++ qq +++  p+++++ ++ r++  ++ +    p+ ++ ++a+++k++k++++ ++p +k +k ++k     
  MELO3C010996P1  96 NSINnnLSCPPGCQIARGVKHIHHPQQqHTHhvPHMNENNYNSRDMLASNDPcptsPVASESTKARRNKRTKEGKTVTTPNKKVSKGPRK----- 185
                     *9987789****************9994334799*******9887765443211114444444444455555555555555554443333..... PP

       GAGA_bind 175 kkkvkkesader.............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiS 240
                        vk+e +d +                             sk+++k +dl+ln+v++Dest+P+P+CsCtG+ rqCYkWGnGGWqSaCCttt+S
  MELO3C010996P1 186 ---VKREAEDLNkimlgksqewkdgigimsggddlnkqlvvSKSDWKGQDLGLNQVAFDESTMPAPICSCTGVIRQCYKWGNGGWQSACCTTTLS 277
                     ...333332211233344456889*********************************************************************** PP

       GAGA_bind 241 vyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +yPLP+++++r+aR++grKmS++af+klL++LaaeG+dls pvDLk+hWAkHGtn+++ti+
  MELO3C010996P1 278 MYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEGHDLSSPVDLKNHWAKHGTNRYITIK 338
                     ************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062179.7E-1041338IPR010409GAGA-binding transcriptional activator
SMARTSM012261.9E-1751338IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDDSGHRENG RHKPDQYKSA QGQWMMQHQP SMKQIMAIMA ERDAAIQERN LALSEKKAAL  60
AERDMAYLQR DAAIAERNNA LLERDNAIAT LQYRENSINN NLSCPPGCQI ARGVKHIHHP  120
QQQHTHHVPH MNENNYNSRD MLASNDPCPT SPVASESTKA RRNKRTKEGK TVTTPNKKVS  180
KGPRKVKREA EDLNKIMLGK SQEWKDGIGI MSGGDDLNKQ LVVSKSDWKG QDLGLNQVAF  240
DESTMPAPIC SCTGVIRQCY KWGNGGWQSA CCTTTLSMYP LPAVPNKRHA RLGGRKMSGS  300
AFNKLLSRLA AEGHDLSSPV DLKNHWAKHG TNRYITIK*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444782.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-153BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A1S3BBW90.0A0A1S3BBW9_CUCME; protein BASIC PENTACYSTEINE6
STRINGXP_008444782.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-146basic pentacysteine 6