PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010984P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 348aa    MW: 37430.4 Da    PI: 6.9169
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010984P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702225.69.5e-701142713153
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrel.......kskkqsalss 88 
                     +g+++CqdCGnqakkdCa+ RCRtCCksrgf+C+thvkstWvpaakrrerqqq aa+++++++++    ++skr re+        + ++sa+++
  MELO3C010984P1 114 AGGMNCQDCGNQAKKDCAYLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQIAALQHQQQQEQfrGGDNSKRLRETqtttavaAAPTASASAC 208
                     6899*****************************************************99999988665666666666622222111112222222 PP

          DUF702  89 tklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                      +l+s +  + le +++P+ev+s+avfrcv+vs++dd++ee+aYqtav+igGhvfkGiLydqG+e
  MELO3C010984P1 209 PRLPSIT--SGLELAQFPSEVNSPAVFRCVKVSAMDDADEEFAYQTAVNIGGHVFKGILYDQGPE 271
                     2222222..3355566***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.5E-68116271IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.5E-27118160IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.9E-27222270IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGFFYLGGG REGPPNKQEE DEEEREQNLF LYRNDQEIYN KGFEIWPQQY NNNNNHQHQQ  60
PNPSLPNHLS FGVGPSRRSF MINDPSDEPS RSAFTLMRPA AAAFAAAAAS AATAGGMNCQ  120
DCGNQAKKDC AYLRCRTCCK SRGFQCQTHV KSTWVPAAKR RERQQQIAAL QHQQQQEQFR  180
GGDNSKRLRE TQTTTAVAAA PTASASACPR LPSITSGLEL AQFPSEVNSP AVFRCVKVSA  240
MDDADEEFAY QTAVNIGGHV FKGILYDQGP ELRYTAAGES SSGHGGDGST HPLNLITGPT  300
STTTSAATST NPAAAAASTA PLLDPSIYPA PLNAFMAGTQ FFPPSRS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444770.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ54e-88SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A1S3BB540.0A0A1S3BB54_CUCME; protein SHI RELATED SEQUENCE 5-like
STRINGXP_008444770.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.17e-71SHI-related sequence 5
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]