PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010752P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 194aa    MW: 21546.8 Da    PI: 7.8456
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010752P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260103.12.4e-3233131199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC+ +C+lapyfpa++ ++f+nv+klFG++nvlk+l+ l++++r +a++++++eA++ra d   G++++i+klq++++ l+a+  
  MELO3C010752P1  33 ACAACKFHRRKCSVECPLAPYFPANRLRDFENVRKLFGVKNVLKILAGLEPDNRFKAVECMIFEANCRAIDLAGGCYKIISKLQSEIALLEAQHR 127
                     7*****************************************************************************************99987 PP

          DUF260  96 llke 99 
                     l+ +
  MELO3C010752P1 128 LILH 131
                     7655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.35532133IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-3233127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNIRQDCTET SADGGEVKDI NFPTKIQAAA AAACAACKFH RRKCSVECPL APYFPANRLR  60
DFENVRKLFG VKNVLKILAG LEPDNRFKAV ECMIFEANCR AIDLAGGCYK IISKLQSEIA  120
LLEAQHRLIL HQLQISRQTA AAISQRGAIR SEFDSDCKHG LTSLLLDCDC SEDWIRKEYF  180
NLNEASFSKA LTN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444461.11e-142PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A0A0LNK61e-110A0A0A0LNK6_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-25LOB domain-containing protein 22