PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010245P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARR-B
Protein Properties Length: 676aa    MW: 73482.4 Da    PI: 6.6615
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010245P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.3e-29211264155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv+av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  MELO3C010245P1 211 KPRVVWSVELHRKFVSAVNQL-GLEKAVPKKILDLMNVEGLTRENVASHLQKYRL 264
                     79*******************.********************************8 PP

2Response_reg85.12.1e-28261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ +++l+++l+k +y +v++++++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ e++ + +  G
  MELO3C010245P1  26 VLAVDDDPICLKVLESLLRKCQY-HVTTTKQSVEALRMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTELVMKGIAHG 118
                     799********************.***************999889*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  MELO3C010245P1 119 ACDYLLKPVRIEELKN 134
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-1681665IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.4E-4423158No hitNo description
SuperFamilySSF521726.12E-3823148IPR011006CheY-like superfamily
SMARTSM004484.5E-3524136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011045.54525140IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.1E-2626134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.52E-3027140No hitNo description
Gene3DG3DSA:1.10.10.601.7E-30208269IPR009057Homeodomain-like
PROSITE profilePS5129411.853208267IPR017930Myb domain
SuperFamilySSF466891.61E-19209268IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-25211264IPR006447Myb domain, plants
PfamPF002491.3E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MTVEGHSVAV VGDDGATDHF PVGMRVLAVD DDPICLKVLE SLLRKCQYHV TTTKQSVEAL  60
RMLRENRNKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTEL VMKGIAHGAC  120
DYLLKPVRIE ELKNIWQHVI RRKKLEPKAK NKFPSQDKVR NGGNEVEQGF SPTSNADSAK  180
FNRKRKDQDD DDDDEGKENG LDSDDPSNQK KPRVVWSVEL HRKFVSAVNQ LGLEKAVPKK  240
ILDLMNVEGL TRENVASHLQ KYRLYLKRIS NVASQQANMV ATFGSKDGTY MRMGSLDGYG  300
DLHGFAGSGR LPNSSLSSYS PVGMLGRLNS PAGMNLRGIT SSGLIQQNSQ NLNCAINNLG  360
KLQPTTMLSP NQTTNLLQGI PTSLEIGQLQ HSKSTTSIGD FNTMNETSGF GVPNSFPETR  420
ANIGNSTYSV SPAPLVLQGT MPTYGNQTSL RVDPLNGETF DIDVGGSNFL DPDPSNGNWQ  480
GAAHLSRFSA TSLTTNEAYP SDQLHSMNSG ISSNPSTIGN ISVDFSSRSA GSASLLDSRD  540
VQCQAGVVGS VIQSMNTMPK QSWEEHKHGY SRNMQHNLGA INSLVSSDGS PTPLNQSFNQ  600
NSVVRDRKVG SSLIVPSNVA SLSFPQHGVV EKLGPNTKTN VDGNYLLNQM KSHDGSIQGS  660
FESLDDIMNS IIKRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-25209270364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818080.0LN681808.1 Cucumis melo genomic scaffold, anchoredscaffold00012.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443880.10.0PREDICTED: two-component response regulator ARR12 isoform X2
SwissprotQ6K8X61e-137ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A1S3B9520.0A0A1S3B952_CUCME; Two-component response regulator
STRINGXP_008443879.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-130response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]