PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009948P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 284aa    MW: 32087.7 Da    PI: 4.4986
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009948P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-2069122356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t++q++ Le+ Fe+++++  e++ +LAkklgL+ rqV vWFqNrRa++k
  MELO3C009948P2  69 KKRRLTHDQVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWK 122
                     56789************************************************9 PP

2HD-ZIP_I/II133.38.5e-4368159192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+++qv++LE++Feee+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy++Lk++yd+l+++ +++ ke++ L++e++
  MELO3C009948P2  68 EKKRRLTHDQVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKASYDSLVSNYDAIVKENAVLKSEVA 159
                     69**************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.68664124IPR001356Homeobox domain
SuperFamilySSF466897.27E-2065126IPR009057Homeodomain-like
SMARTSM003891.1E-1867128IPR001356Homeobox domain
PfamPF000464.4E-1869122IPR001356Homeobox domain
CDDcd000866.97E-1969125No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2170131IPR009057Homeodomain-like
PRINTSPR000313.1E-695104IPR000047Helix-turn-helix motif
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PRINTSPR000313.1E-6104120IPR000047Helix-turn-helix motif
PfamPF021838.3E-18124164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MESGRFLFNP PPYGGNMLYL GGAGGDPCLR GGRTMMSMSM NESPKGRPFF RSPDDLYDDE  60
YYDEFYPEKK RRLTHDQVQM LEKNFEEENK LEPERKSQLA KKLGLQPRQV AVWFQNRRAR  120
WKTKQLERDY DVLKASYDSL VSNYDAIVKE NAVLKSEVAS LTEKCLAKEL DGGEATIPSI  180
TSELLLADIT NISIPQSGRK AEDRLSSGSD SSAVVDDNCP QLIDSGDSYF PSIEYPQCAH  240
LPNGLQMEDN DTNDNSNYLF SDMFATTNQQ SQEGRPPAWW AWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443498.10.0PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022832e-83HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A1S3B8600.0A0A1S3B860_CUCME; homeobox-leucine zipper protein HAT5
STRINGXP_008443498.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112833039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-61homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]