PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009614P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 380aa    MW: 41136.1 Da    PI: 6.1204
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009614P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.4e-17227281256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  MELO3C009614P1 227 RKKLRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 281
                     788899***********************************************98 PP

2HD-ZIP_I/II124.74.2e-40227317192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+ke +eLr +lk
  MELO3C009614P1 227 RKKLRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELR-ALK 317
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-18211284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-17213281IPR009057Homeodomain-like
PROSITE profilePS5007116.973223283IPR001356Homeobox domain
SMARTSM003891.3E-14225287IPR001356Homeobox domain
CDDcd000863.07E-14227284No hitNo description
PfamPF000467.3E-15227281IPR001356Homeobox domain
PROSITE patternPS000270258281IPR017970Homeobox, conserved site
PfamPF021831.0E-10283317IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-25283326IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MVELGLSLGD HPSSNSNNNT NKPFSNFLSK PISSSSNSSS SLMALGFCVG LIGRHSASAS  60
ASVQDDEEDD DELDDDDDRK TVLAGSTSGL DPPVQLDLLP LAPVPRSSSS SSPLLPFPWL  120
SHHLMGEVGG SSEGGERVET LDVKRVLVEE REDRVAAVAV AALSSPNSTV SCFEMEFGGG  180
GGGGIRRKRS WDHMEMETER GGGSGGGCSR IMSDDEDNNA SASAAARKKL RLSKQQSAFL  240
EESFKEHTTL NPKQKLALAK QLNLRPRQVE VWFQNRRART KLKQTEVDCE YLRRCCETLT  300
EENRRLQKEL QELRALKTSQ PFYMQLPATT LTMCPSCERV ATTTTTTTTA PTTPAPSSAL  360
CLANKPKILP FPHLHQAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275283RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443033.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466651e-87HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1S3B7U40.0A0A1S3B7U4_CUCME; homeobox-leucine zipper protein HOX11
STRINGXP_008443033.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-56homeobox from Arabidopsis thaliana