PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009350P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 772aa    MW: 85822.4 Da    PI: 6.7338
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009350P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.1e-085294347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT eE+e +  a +q G++ +++I  +++  +   q++++++ +
   MELO3C009350P1 52 AWTREEEESFFTALRQVGKN-FEKITCHVQ-SKNKDQVRHYYYRL 94
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-114399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-54797IPR009057Homeodomain-like
PROSITE profilePS5129313.6234899IPR017884SANT domain
SMARTSM007172.3E-54997IPR001005SANT/Myb domain
CDDcd001671.16E-55295No hitNo description
PfamPF002499.4E-65294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MQTDLIVSSN SETHLHSETI IAHVGDQGIA ASTPDHVIEP LPAKKPTRQW AAWTREEEES  60
FFTALRQVGK NFEKITCHVQ SKNKDQVRHY YYRLVRRMNK LLAPGLCLDA KNSKDTNAAM  120
LRWWSLLEKY SCKASKLHLK PRRFKIFVEA LEHQLLKDRK KNVRKRPLQG ENCPPPIPNA  180
VSNQSRALGH DGRAVKLVLV DTQNIPKLGP RKTTSRRNVN VGINRGNNGG YPTVLKPSRQ  240
RRKSEGGVSS AAYKKWEKAA IAGVSLVADA AEHLERTITN KDVLRDQNTL GKKSTDPAGS  300
PLLLLPPLQP NSLIDVASIK LKLQLFPVDD GTRRALESDK HNPYLELTLS TRKKISSVLE  360
HLSRKWGNSS AAHGELMLFP YSIQRKSLTD CQRWTQDSFE SAGDVYATIG RPQVFRLRYG  420
WCSNAEHESV ELQTSVPAYC IQDDHIMDAR DIEGRIVHAA SIDAQPVDFN KDEVGTFTKN  480
MSTPTAPCES ERCISARPND LLRSSDPVLN MSWDKKNAAD RTIIQRSDDV DELKLSNGTS  540
LSAGEWADSL TNISIGDLLS GVSQDVDANC VDTPLAEGTQ CLQQIPFSCD SFDAAIAAHI  600
SRQQDKTVTQ PTLASHASSI WDAEETCDAF SFQKNPVTLQ EVPSSFTFSS LRGCKHVART  660
NSMGYSHMTE DLPGSESRTE DHIQGDLMDE CQSDPQIAET KDIDELADIY WPDSLGPLDL  720
DLPSTNKYHN EELILGDSLS SLNRLIASSL DAFQNCSFFG FDKKEPSAFN S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442697.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_008442696.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
RefseqXP_008442695.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A0A0LE120.0A0A0A0LE12_CUCSA; Uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1