PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009160P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 306aa    MW: 35985.9 Da    PI: 7.4517
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009160P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.86.8e-2458140186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++ + +r e+++++ ++k++k lWe  ++km+e+gf+rs++qCk+kw+nl +ryk ++++e +    s++++p++++l+
  MELO3C009160P1  58 QWSIQETKEFLMIRAELDQTFMETKRNKLLWEITASKMKEKGFNRSAEQCKCKWKNLVTRYKGCETMEPEI---SRQQFPFYTELQ 140
                     7********************************************************************97...55679****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.13E-2257122No hitNo description
PfamPF138372.7E-1958142No hitNo description
PROSITE profilePS500906.81859115IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEGHHHPHPH PPHPHPLIQL HQQQQIQHPP PPPPPHLHQS LAVDQAATGT AIADRFPQWS  60
IQETKEFLMI RAELDQTFME TKRNKLLWEI TASKMKEKGF NRSAEQCKCK WKNLVTRYKG  120
CETMEPEISR QQFPFYTELQ AIFGARRERI LWAEVESGGS GLKKKMMVLS SDDEDENDDS  180
DGDGGETKVS GRKRKKVKGT TIGGAEGSGK SSMNELKEIL EDFMNQQMQM EMQWREAFEA  240
REKERQMKEM EWRRNMEALE HERIMLERRW REREEQRRMR EEVRAEKRDA LITALLNKLR  300
RDDHI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191195RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM8548200.0HM854820.1 Cucumis melo subsp. melo clone 00002, complete sequence.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442411.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW04e-71TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLE5GBE80.0E5GBE8_CUCME; Transcription factor
STRINGPOPTR_0006s10240.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-64Trihelix family protein