PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008779P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 202aa    MW: 22171.2 Da    PI: 8.7557
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008779P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.91.1e-4591081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql++l+ +l 
  MELO3C008779P1   9 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLCKLQMDLT 103
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  MELO3C008779P1 104 CAKSE 108
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1168109IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-459106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MASSSSNSPC AACKFLRRKC QPECVFAPYF PPDQPQKFAN VHKVFGASNV TKLLNELHPH  60
QREDAVNSLA YEADMRLRDP VYGCVGVISL LQHQLCKLQM DLTCAKSELS KYQNLGIEKP  120
PASVQFCSRS TAQPLSRSIF PSRSTTTTTT LMMLRRNFDG GSNYDGLLAV NVTASIGNLS  180
HQFQQTRAAA GDDRRGTLDH S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
GenBankLN6818460.0LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441920.11e-119PREDICTED: LOB domain-containing protein 6
RefseqXP_008441921.11e-119PREDICTED: LOB domain-containing protein 6
RefseqXP_008441922.11e-119PREDICTED: LOB domain-containing protein 6
SwissprotO044796e-78LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A0A0LML71e-117A0A0A0LML7_CUCSA; Uncharacterized protein
STRINGVIT_00s0340g00090.t013e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-74LBD family protein