PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007882P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GATA
Protein Properties Length: 275aa    MW: 30940.3 Da    PI: 8.2556
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007882P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.2e-19197230134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+Cg+ kTp+WR gp g k+LCnaCG+++++ +
  MELO3C007882P1 197 CSHCGVQKTPQWRAGPLGAKSLCNACGVRFKSGR 230
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.0E-6825273IPR016679Transcription factor, GATA, plant
SMARTSM004012.1E-15191245IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308191227IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14194254No hitNo description
Gene3DG3DSA:3.30.50.101.6E-14194228IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.16E-14196245No hitNo description
PROSITE patternPS003440197222IPR000679Zinc finger, GATA-type
PfamPF003205.5E-17197230IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDMDSAFNMH LIKDFTFKST PKLHFDDFWS SNLQNASSPS SDHIFVDQFL NFSDEEQQED  60
GEKNNHSSLS PPLQLQQHHD TDQNSNHSST NSSEDDFWSI SSTDFEDLAW LSQLVADSTQ  120
EEYSAPPPPP SVFSTHKPRN PLPKIQSYLN TPFPSKPRTK RPKISAGVWS LTPLPAKKSK  180
KNPADEGSGR VQAGRRCSHC GVQKTPQWRA GPLGAKSLCN ACGVRFKSGR LFPEYRPACS  240
PTFSNELHSN HHRKVLEMRR KKEREKPHSG VELV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440788.10.0PREDICTED: GATA transcription factor 7-like
SwissprotO655155e-51GATA7_ARATH; GATA transcription factor 7
TrEMBLA0A0A0KJA51e-154A0A0A0KJA5_CUCSA; Uncharacterized protein
STRINGVIT_04s0023g02880.t015e-58(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.15e-52GATA transcription factor 7