PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007877P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 329aa    MW: 35599 Da    PI: 7.411
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007877P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.14e-711032583154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrelkskkqsalsstk 90 
                      g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaakrrerq++laa+++++ +++        ++++kr+r     ++s+l++t 
  MELO3C007877P1 103 GGGISCQDCGNQAKKDCSHMRCRTCCKSRGFHCETHVKSTWVPAAKRRERQDKLAALQTHHHHQQqqlqlhgGDNNPKRHR---DYNSSSLACTL 194
                     5789****************************************************9988877776777554444445555...569999***** PP

          DUF702  91 lssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     ++++++++ le+ ++P+e++s+avfrcvrvss dd ++++aYqtav+igGhvfkGiLydqG+e+
  MELO3C007877P1 195 IPTNNNTSGLEIGNFPAELNSPAVFRCVRVSSADDTDDQYAYQTAVNIGGHVFKGILYDQGPEN 258
                     **************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.7E-67105257IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27107149IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.4E-27209256IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MSGFFTLGGG GGGREEEQNN NRPNQFIHPP PDSSLFWYKA GNVELWQQQQ QHHHHHQEQP  60
LFQTQSRTTT TTTPYSAPLT VRNSDESSSR SGNFMMISSG SGGGGISCQD CGNQAKKDCS  120
HMRCRTCCKS RGFHCETHVK STWVPAAKRR ERQDKLAALQ THHHHQQQQL QLHGGDNNPK  180
RHRDYNSSSL ACTLIPTNNN TSGLEIGNFP AELNSPAVFR CVRVSSADDT DDQYAYQTAV  240
NIGGHVFKGI LYDQGPENNY IPPGETSSGG GGSSSGVQPL NFITGAADTT TGSGGSTAAL  300
PLLDPSSLYS TPLNSFMAGT QFFLPPRS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440782.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9XGX03e-82SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A1S3B2J60.0A0A1S3B2J6_CUCME; protein SHI RELATED SEQUENCE 1
STRINGXP_008440782.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.13e-71Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Islam MA, et al.
    Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.
    PLoS ONE, 2013. 8(1): p. e53377
    [PMID:23308204]
  2. Pfannebecker KC,Lange M,Rupp O,Becker A
    An Evolutionary Framework for Carpel Developmental Control Genes.
    Mol. Biol. Evol., 2017. 34(2): p. 330-348
    [PMID:28049761]
  3. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]