PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007809P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 216aa    MW: 24600.9 Da    PI: 9.7593
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007809P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.7e-2053106457
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     ++++++eq++ Le  F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  MELO3C007809P1  53 KRKLSSEQVKLLEMNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 106
                     56899***********************************************95 PP

2HD-ZIP_I/II1171.1e-3752143293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     kkr+ls+eqvklLE++F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+a+d++  ++++Le+e  +++e+lke
  MELO3C007809P1  52 KKRKLSSEQVKLLEMNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKLEEEYSTLKKAHDSVLLQKSHLESELVKVKEQLKE 143
                     9****************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.79547107IPR001356Homeobox domain
SMARTSM003894.3E-1850111IPR001356Homeobox domain
SuperFamilySSF466892.26E-1851116IPR009057Homeodomain-like
CDDcd000869.21E-1552108No hitNo description
PfamPF000464.7E-1753106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.9E-2154114IPR009057Homeodomain-like
PRINTSPR000311.4E-57887IPR000047Helix-turn-helix motif
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PRINTSPR000311.4E-587103IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MAAANLRPDA EKLITLFPSL QPRSTGEGNK PTKRRRRRSK AKEGGGGAGS LKKRKLSSEQ  60
VKLLEMNFGN EHKLESERKD RLASELGLDP RQVAVWFQNR RARWKNKKLE EEYSTLKKAH  120
DSVLLQKSHL ESELVKVKEQ LKEAKNEIRK MVEGSEVRNN SSNSPSSSVT MEAVEEAAVV  180
PLGELFFEEY EDVFYCMQDN NYNQGLDWAL NLNFM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13237KRRRRR
23553RRRSKAKEGGGGAGSLKKR
33554RRRSKAKEGGGGAGSLKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143500.11e-122PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotQ9ZU704e-56ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLA0A0A0KGE81e-121A0A0A0KGE8_CUCSA; Uncharacterized protein
STRINGXP_004143500.11e-122(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-44homeobox protein 40
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]