PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007736P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 288aa    MW: 32819.1 Da    PI: 4.4457
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007736P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-192073356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  MELO3C007736P2 20 KKRRLSVDQVKALEKTFEIENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 73
                    456899***********************************************9 PP

2HD-ZIP_I/II1278.4e-4119111193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy  Lk++y++lk++ ++L++++++L +e+ke
  MELO3C007736P2  19 EKKRRLSVDQVKALEKTFEIENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGLLKANYESLKRSFDTLQQDNDALLKEIKE 111
                     69*************************************************************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.26E-191477IPR009057Homeodomain-like
SMARTSM003895.4E-191879IPR001356Homeobox domain
PROSITE profilePS5007116.9891975IPR001356Homeobox domain
PfamPF000462.7E-162073IPR001356Homeobox domain
CDDcd000861.79E-172076No hitNo description
Gene3DG3DSA:1.10.10.602.3E-202282IPR009057Homeodomain-like
PRINTSPR000317.6E-64655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000317.6E-65571IPR000047Helix-turn-helix motif
PfamPF021832.9E-1675116IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MLDGLDEEGS IEEHCHVGEK KRRLSVDQVK ALEKTFEIEN KLEPERKVKL AQELGLQPRQ  60
VAVWFQNRRA RWKTKQLERD YGLLKANYES LKRSFDTLQQ DNDALLKEIK ELKSKLEEEK  120
TESNLSVKEE IFVSESDNLL IEQTTNHLPV DHISLPVASD HSDDFDYESF RTVGADDGDD  180
QRVEVSLFPD FKDGSSDSDS SAILNEDNSP NAVVSSATAG MLQSHHQILS SPATSLNCFP  240
FQKATYNNAQ QFVKIEEHNF FSGEETCNLF SDEQAPSMHW YCPDQWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16775RRARWKTKQ
28893ESLKRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440572.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLA0A1S3B2640.0A0A1S3B264_CUCME; homeobox-leucine zipper protein ATHB-6-like
STRINGXP_008440572.10.0(Cucumis melo)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.17e-59homeobox protein 6