PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007377P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 722aa    MW: 79145.6 Da    PI: 6.3176
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007377P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85.2e-2050105156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++  ++t++q++e+e++F+++++p+ ++r eL+++lgL+  qVk+WFqN+R+++k
  MELO3C007377P1  50 KKRYNRHTQHQIQEMEAFFKECPHPDDKQRMELSRELGLEPLQVKFWFQNKRTQMK 105
                     577789***********************************************998 PP

2START182.13.1e-572384592206
                     HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     la + ++el ++a+ +ep+Wv           +n+ e+l++f  + v     +++ea+r+s+vv+m++++lv +++d   qW++ +     +a+t
  MELO3C007377P1 238 LAVSGMEELRRMAQGGEPLWVAGDgkssgeVVLNEAEYLRSFGGGIVgkpmgFRTEASRVSAVVFMNHMKLVDIFMDAT-QWSTVFCgivsRAST 331
                     5677799**************88766667777888888888855555********************************.******99999**** PP

                     EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     +e +s+g      gal++m+ae+q++splvp R+ +fvRy++q+++g+w+++dvS+d  ++ p  ++  R    pSg+li++++ng+sk+twveh
  MELO3C007377P1 332 VEILSPGlsgnfnGALHVMSAEFQVPSPLVPtRENYFVRYCKQQTDGSWAVADVSLDTLRPSPI-PNTRR---KPSGCLIQELPNGYSKITWVEH 422
                     ***************************************************************5.66666...********************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     v++++  ++ ++r lv+sgla+gak+wvatl+rq e+
  MELO3C007377P1 423 VEVDETGVPTMYRTLVNSGLAFGAKRWVATLDRQSER 459
                     *********************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-1941107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-2142105IPR009057Homeodomain-like
PROSITE profilePS5007117.0747107IPR001356Homeobox domain
SMARTSM003891.5E-1948111IPR001356Homeobox domain
CDDcd000866.31E-1949108No hitNo description
PfamPF000461.2E-1750105IPR001356Homeobox domain
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PROSITE profilePS5084843.569228462IPR002913START domain
SuperFamilySSF559613.02E-30231460No hitNo description
CDDcd088751.86E-111232458No hitNo description
SMARTSM002342.3E-52237459IPR002913START domain
PfamPF018521.4E-48239459IPR002913START domain
Gene3DG3DSA:3.30.530.204.8E-7327456IPR023393START-like domain
SuperFamilySSF559613.3E-21481713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MFDPDMFDTT HHHMLEELEN MRDDDFDNKS GAEILESACG IDQQQQRSKK KRYNRHTQHQ  60
IQEMEAFFKE CPHPDDKQRM ELSRELGLEP LQVKFWFQNK RTQMKAQHER HENAILKAEN  120
EKLRAENIRY REAFAHSTCP NCGSSSTALG EMSFDDQHLR IENSRLRDEI ERMSGYGSKC  180
TKPYYQLPTN APTRSLDLGI TNFGPQSSGF VGEMYGAADF FRSISRPSEG EKPVIVELAV  240
SGMEELRRMA QGGEPLWVAG DGKSSGEVVL NEAEYLRSFG GGIVGKPMGF RTEASRVSAV  300
VFMNHMKLVD IFMDATQWST VFCGIVSRAS TVEILSPGLS GNFNGALHVM SAEFQVPSPL  360
VPTRENYFVR YCKQQTDGSW AVADVSLDTL RPSPIPNTRR KPSGCLIQEL PNGYSKITWV  420
EHVEVDETGV PTMYRTLVNS GLAFGAKRWV ATLDRQSERF ATSIATTIPT GDLRVISSIE  480
GRKSMLKLAE RMVTSFCAGV GASSVHAWTA LPAAAGDEVR VVTRKSTDEP GRPPGVVLSA  540
ATSFWIPVSP KVVFDFLRKE KSRSEWDILS NGGLVQEMAH IANGRHSGNC VSLLRVNSAN  600
SSQSNMLILQ ESCTDSTGSY VIYAPVDTVA MNVVLSGCDP DYVALLPSGF AILPDGPGGG  660
GNNGGGILEL GSGGSLITVA FQILVDSVPT ARLSIGSVAT VNSLIKCTVE RIRAAVMRES  720
P*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439968.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
RefseqXP_008439969.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A1S3AZL70.0A0A1S3AZL7_CUCME; homeobox-leucine zipper protein PROTODERMAL FACTOR 2
STRINGXP_008439968.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2470333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]