PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007351P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GeBP
Protein Properties Length: 218aa    MW: 24244.7 Da    PI: 9.5706
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007351P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573971.9e-301791997
          DUF573 19 lidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                    +id+ a++g++ps d++af++f+kks++++v+k ql++KirrLKkK++++ ++ k+g +p+fsk+h+qk felsk+iWg
  MELO3C007351P1  1 MIDYSAEKGSDPSLDMNAFHDFIKKSLHVDVTKAQLMDKIRRLKKKYRNNADRGKKGADPTFSKAHEQKGFELSKRIWG 79
                    9*****************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.8E-26179IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MIDYSAEKGS DPSLDMNAFH DFIKKSLHVD VTKAQLMDKI RRLKKKYRNN ADRGKKGADP  60
TFSKAHEQKG FELSKRIWGG EGILRTPAVE QLKPNANGTP KKNQRGNTSK ALASLKADLL  120
PSPDAPKEDD SMKVDDCEAP SGCMDGFVAF ERSLGAVGLP ESFLKPGLEL IGQSKRTELE  180
EEWKKLHLAE LELFLKRTEL IRDQTKLILD AYKSSSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439944.11e-159PREDICTED: mediator-associated protein 1
TrEMBLA0A1S3B0Q11e-158A0A1S3B0Q1_CUCME; mediator-associated protein 1
STRINGXP_008439944.11e-158(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.11e-28DNA-binding storekeeper protein-related transcriptional regulator