PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007098P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 241aa    MW: 27293.8 Da    PI: 7.8636
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007098P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.3e-40151141100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrrkC +dC++ap+fpa+qpkkf++vh+++Gasnv+k+lkal+ +ere++++slv+eAear+rdPv+G+v++i++lq +l+ l++el+
  MELO3C007098P1  15 PCASCKFLRRKCDADCIFAPHFPADQPKKFEVVHRIYGASNVSKILKALRYDEREETVNSLVFEAEARLRDPVRGCVALISDLQDRLQMLQTELS 109
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +++e
  MELO3C007098P1 110 IARRE 114
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.71814115IPR004883Lateral organ boundaries, LOB
PfamPF031959.4E-3915112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSSFNSQPQK TYGSPCASCK FLRRKCDADC IFAPHFPADQ PKKFEVVHRI YGASNVSKIL  60
KALRYDEREE TVNSLVFEAE ARLRDPVRGC VALISDLQDR LQMLQTELSI ARRELSSYMP  120
SELPPNYSSY MASKLPPNWS YMASKLRPNS SYMASKLRPN LSYMISELLP KWPGESSTSQ  180
RPMMEGQSSS QRVDGFGTTN YYGINNDDDR RHVVFQHPVT TTEQLLPATE QPPSQDSIDF  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439580.10.0PREDICTED: LOB domain-containing protein 12-like
SwissprotQ9FKZ33e-44LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0A0KIS21e-121A0A0A0KIS2_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-45ASYMMETRIC LEAVES 2-like 1