PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006887P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82947.2 Da    PI: 5.7435
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006887P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73e-2155110156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++eLe +F+++++p+ ++r eL+++lgL+++qVk+WFqNrR+++k
  MELO3C006887P1  55 RKKYHRHTPHQIQELEIFFKECPHPDDKQRNELSRRLGLETKQVKFWFQNRRTQMK 110
                     7999*************************************************999 PP

2START173.81.1e-542634832205
                     HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la++a++elvk+a+ + p+W +         +n de+ ++f++s +      ++ea r++++v+ ++  lve+l+d + +W e+++    +a+t+
  MELO3C006887P1 263 LALAAMNELVKMAQMDGPLWIRTQddsskATLNLDEYSRTFPSSAGikhttWTTEATRDTTMVIINSLALVETLMDAN-RWAEMFPcliaRATTI 356
                     6899******************99998888999********99988**9999**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vissg      galqlm ael +lsplvp R   f+R+++q+ +g w++vdvS+ + ++ +   s+  +++lpSg+++++++ng skvtwveh+
  MELO3C006887P1 357 DVISSGmggtrnGALQLMHAELRVLSPLVPvRTLKFLRFCKQHADGLWAVVDVSIGEGSNSN---SFFGCRRLPSGCVVQDMPNGFSKVTWVEHT 448
                     **********************************************************9965...8***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     ++++ ++h+l+r+l++sg  +g ++w+atlqrqc 
  MELO3C006887P1 449 EYDETVIHQLYRQLISSGSGFGSQRWLATLQRQCD 483
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-2039112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2241112IPR009057Homeodomain-like
PROSITE profilePS5007117.49152112IPR001356Homeobox domain
SMARTSM003894.3E-2054116IPR001356Homeobox domain
CDDcd000862.66E-2055112No hitNo description
PfamPF000467.5E-1955110IPR001356Homeobox domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PROSITE profilePS5084839.55253487IPR002913START domain
SuperFamilySSF559612.47E-29254484No hitNo description
SMARTSM002345.1E-34262484IPR002913START domain
CDDcd088751.05E-110262482No hitNo description
PfamPF018526.3E-47263483IPR002913START domain
SuperFamilySSF559613.43E-17512745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MDGYGEVCLL GDGFDPIGIV RIREDEYDSR SGSDNIDGAV SGDDHDANDE QPPKRKKYHR  60
HTPHQIQELE IFFKECPHPD DKQRNELSRR LGLETKQVKF WFQNRRTQMK TQIERHENAI  120
LKQENDKLRA ENSVMKDAIS NPTCSTCGGP SIPVQLSFEE HQLRIENARL REELHRLYAV  180
TNKFLGWPVV PFVNHGSSPS SDSCLELSVG RNGPGNLSTV SDSMGLNLGN GLFSAGPVMP  240
ISKPDIGMLS NDIPLERTIY VDLALAAMNE LVKMAQMDGP LWIRTQDDSS KATLNLDEYS  300
RTFPSSAGIK HTTWTTEATR DTTMVIINSL ALVETLMDAN RWAEMFPCLI ARATTIDVIS  360
SGMGGTRNGA LQLMHAELRV LSPLVPVRTL KFLRFCKQHA DGLWAVVDVS IGEGSNSNSF  420
FGCRRLPSGC VVQDMPNGFS KVTWVEHTEY DETVIHQLYR QLISSGSGFG SQRWLATLQR  480
QCDCLAILMS STIPTEDPAG ISPSGRRSML KLSQRMVDNF CSGVCSSTLH KWDKLVVGNI  540
SEDVKVMARK SINDPGEPPG IVLSAATSVW MPVTQQRLFE FLQDECLRSE WDILSNSRPM  600
LEMLRISKGQ GPDNRVSLLC ANPMNANENT MFILQETWTD VSGSLVVFAP VDTSSVNLVM  660
RGGDSAYVSL LPSGFAILPI DQSNYACTND QDASVKSSLN SGHGGACLLT VAFQILVNSL  720
PTAKLTVESV ETVNHLISCT IQKIKTALQV S*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439184.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3AY760.0A0A1S3AY76_CUCME; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_008439184.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]