PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006086P3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 317aa    MW: 35227 Da    PI: 10.1005
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006086P3genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-135599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   MELO3C006086P3 55 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 99
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-1749105IPR009057Homeodomain-like
PROSITE profilePS5129415.21150104IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-653105IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1853102IPR006447Myb domain, plants
SMARTSM007175.3E-1154102IPR001005SANT/Myb domain
PfamPF002492.6E-115599IPR001005SANT/Myb domain
CDDcd001671.85E-857100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MNMSHFPGID SVRTPTPSLR TAALPTSTSN SVAAFPVSED ASKKIRKPYT ITKSRESWTE  60
QEHDKFLEAL QLFDRDWKKI EAFVGSKTVI QIRSHAQKYF LKIQKSGKSE HVPPPRPKKK  120
ASHPYPQKAP KNATTQHPGM YQPLSSPFEP RYIYIPDSAA GFGLPSPNAT FSSWSCSPVP  180
TIDVSQVPKV GGPTLAHSSS SESTPRTWKL GEISDQGNQS MRNRVMPDFA QVYSFIGSVF  240
DPTVSGHIQR LRKMDPINLE TALLLMQNLA INLISPEFED HRKLISSYDE DMKKAKSGSL  300
FNSLHNVRSD NTILSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132601e-116LN713260.1 Cucumis melo genomic chromosome, chr_6.
GenBankLN6818481e-116LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437997.10.0PREDICTED: protein REVEILLE 6 isoform X1
RefseqXP_008437996.10.0PREDICTED: protein REVEILLE 6 isoform X1
RefseqXP_008437995.10.0PREDICTED: protein REVEILLE 6 isoform X1
RefseqXP_008437994.10.0PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-106RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0A0L4360.0A0A0A0L436_CUCSA; Uncharacterized protein
STRINGVIT_15s0046g02260.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-108MYB_related family protein