PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005978P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 262aa    MW: 29255.8 Da    PI: 8.1413
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005978P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19108162256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  LAk+l+Lt rqV vWFqNrRa+ k
  MELO3C005978P1 108 RKKLRLSKEQSMVLEETFKEHNTLNPKQKLALAKQLNLTPRQVEVWFQNRRARTK 162
                     788899***********************************************98 PP

2HD-ZIP_I/II127.74.8e-41108197191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  MELO3C005978P1 108 RKKLRLSKEQSMVLEETFKEHNTLNPKQKLALAKQLNLTPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELR-AL 197
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.3E-19181IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.606.8E-2091158IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2094165IPR009057Homeodomain-like
PROSITE profilePS5007117.734104164IPR001356Homeobox domain
SMARTSM003895.2E-17106168IPR001356Homeobox domain
PfamPF000461.5E-16108162IPR001356Homeobox domain
CDDcd000864.93E-16108165No hitNo description
PROSITE patternPS000270139162IPR017970Homeobox, conserved site
PfamPF021832.0E-11164198IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.7E-27164207IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGGRDDDLGL TLSLGFGVTT QPTHMQRPSM HNHLRKTSWN ELFQFSDRNA DSRSFLRGID  60
VNRLPTGVDG EEENGVSSPN TEAEAERASC SRGSDDEDGG GGDGDASRKK LRLSKEQSMV  120
LEETFKEHNT LNPKQKLALA KQLNLTPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCENL  180
TEENRRLQKE VQELRALKLS PQLYMHMNPP TTLTMCPQCE RVAVSSSSST SAATTTRHPA  240
AAGVQRTSMA INPWAVLPIQ R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106112SRKKLRL
2156164RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818481e-172LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132601e-172LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437820.11e-161PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP466021e-99HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A1S3AUW71e-159A0A1S3AUW7_CUCME; homeobox-leucine zipper protein HAT3-like
STRINGXP_008437820.11e-160(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-79homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  3. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]