PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005840P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 312aa    MW: 34367.9 Da    PI: 9.0252
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005840P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.4e-125195147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   MELO3C005840P1 51 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 95
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.07E-1645101IPR009057Homeodomain-like
PROSITE profilePS5129414.1846100IPR017930Myb domain
TIGRFAMsTIGR015571.5E-184998IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.7E-649101IPR009057Homeodomain-like
SMARTSM007176.5E-105098IPR001005SANT/Myb domain
PfamPF002494.5E-105195IPR001005SANT/Myb domain
CDDcd001671.16E-75396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVSNNPNPSE GFYLDPSGMA LPGLGPFATT MAASEDMSKK IRKPYTITKS RESWTEPEHD  60
KFLEALQLFD RDWKKIEAFV GSKTVIQIRS HAQKYFLKVQ KTGGGEHLPP PRPKRKASHP  120
YPQKASKNVA MPSQVPGSLQ STSPPVEPGY TIRPDSSSIL TCPGPAGAAS SWTVNSVQPL  180
NSSQVPTTAN NCCSSTESPS KARPLVETID QGSNNHSLRV LPDFSQVYRF IGSVFDPNAS  240
GHLQKLKRMD PIDVETVLLL MRNLSINLIS PDFEDHKKLL SSYEIDSRPI RHGDMDKPIY  300
IDDHKSNLVS N*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132631e-109LN713263.1 Cucumis melo genomic chromosome, chr_9.
GenBankLN6818951e-109LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437533.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-130RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0A0KJM40.0A0A0A0KJM4_CUCSA; Uncharacterized protein
STRINGVIT_16s0050g01180.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-131MYB_related family protein