PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005327P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 198aa    MW: 22542.6 Da    PI: 9.9794
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005327P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-194094256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    rk+ +++k+q + Lee F+ n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  MELO3C005327P1 40 RKKLRLSKDQSRLLEESFRLNHTLNPKQKEGLAMELKLKPRQVEVWFQNRRARSK 94
                    788899***********************************************98 PP

2HD-ZIP_I/II114.37.4e-3740129191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q++lLEesF+ +++L+p++K+ la eL+l+prqv+vWFqnrRAR k+kq+E ++e++kr++ +l+e+n+rL+ e eeLr ++
  MELO3C005327P1  40 RKKLRLSKDQSRLLEESFRLNHTLNPKQKEGLAMELKLKPRQVEVWFQNRRARSKLKQTELECEYMKRCFGSLTEQNRRLQWELEELR-AI 129
                     69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-181697IPR009057Homeodomain-like
SuperFamilySSF466894.28E-192897IPR009057Homeodomain-like
PROSITE profilePS5007117.0383696IPR001356Homeobox domain
SMARTSM003891.5E-1538100IPR001356Homeobox domain
CDDcd000861.15E-133997No hitNo description
PfamPF000461.3E-164094IPR001356Homeobox domain
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
SMARTSM003401.1E-1896139IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-796129IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MNRVPAEGEA EADWARGQSV EEEGEEESSI NNNNGGTQPR KKLRLSKDQS RLLEESFRLN  60
HTLNPKQKEG LAMELKLKPR QVEVWFQNRR ARSKLKQTEL ECEYMKRCFG SLTEQNRRLQ  120
WELEELRAIK VAPPAVVSRH NRSQPPLSRS TITICPRCER ITSNKNTVAE NATTTATAMQ  180
SEVVLSALKL RQPSRAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18896RRARSKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818951e-179LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132631e-179LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467159.11e-142PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX14e-68HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH384e-68HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A1S3CSV71e-140A0A1S3CSV7_CUCME; homeobox-leucine zipper protein HOX3-like
STRINGXP_008467159.11e-141(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.19e-54homeobox-leucine zipper protein 17