PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005239P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 281aa    MW: 31172.7 Da    PI: 10.0992
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005239P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind329.41e-10012801301
       GAGA_bind   1 mdddgsrernkgyyepaaslk.enlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkl 81 
                     mddd+ + rn+gyyep+  +k ++lglqlms+i+erd k     r+  + + + ++++++rd         m++  rd++  +        ++++
  MELO3C005239P1   1 MDDDALNMRNWGYYEPS--FKgNHLGLQLMSTISERDMKHflpgRDPSV-MVNANGSFHPRDcvvseapvhMNY-VRDNWGGN--------RDRF 83 
                     9***9999*******99..66257***************99*9999999.9***********888888888888.77888777........789* PP

       GAGA_bind  82 lalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     l++l++++s        + v+++t+ ++slq      l++++     ++++ a  +ee + +++  k kk++++++ pk++kakk++k +    k
  MELO3C005239P1  84 LNMLPANHS--------YPVMPETSGAHSLQI-----LQPPSSS---RDEIAASRVEEPPVKKEGGKAKKRQSSEAGPKTPKAKKPRK-P----K 157
                     *****9997........8899*******9999.....5554444...33344555555444444444455555566677777777777.1....2 PP

       GAGA_bind 177 kvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLek 271
                     +++++   +r+k +kk+idlv+ng+++D+s +P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP+s krrgaRiagrKmSqgafkk+Lek
  MELO3C005239P1 158 DTSTAV--QRVKPPKKNIDLVINGIDMDISCIPIPVCSCTGAPHQCYRWGCGGWQSACCTTNISTYPLPMSDKRRGARIAGRKMSQGAFKKVLEK 250
                     223333..689************************************************************************************ PP

       GAGA_bind 272 LaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     Laa+Gy+++np+DL++hWA+HGtnkfvtir
  MELO3C005239P1 251 LAADGYNFANPIDLRTHWARHGTNKFVTIR 280
                     *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.3E-1661280IPR010409GAGA-binding transcriptional activator
PfamPF062177.2E-1111280IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDDDALNMRN WGYYEPSFKG NHLGLQLMST ISERDMKHFL PGRDPSVMVN ANGSFHPRDC  60
VVSEAPVHMN YVRDNWGGNR DRFLNMLPAN HSYPVMPETS GAHSLQILQP PSSSRDEIAA  120
SRVEEPPVKK EGGKAKKRQS SEAGPKTPKA KKPRKPKDTS TAVQRVKPPK KNIDLVINGI  180
DMDISCIPIP VCSCTGAPHQ CYRWGCGGWQ SACCTTNIST YPLPMSDKRR GARIAGRKMS  240
QGAFKKVLEK LAADGYNFAN PIDLRTHWAR HGTNKFVTIR *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466905.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD01e-108BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A1S3CSG10.0A0A1S3CSG1_CUCME; protein BASIC PENTACYSTEINE2-like
STRINGXP_008466905.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-107basic pentacysteine 2