PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005238P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family BBR-BPC
Protein Properties Length: 278aa    MW: 30971.6 Da    PI: 10.5157
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005238P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind314.92.7e-9612771301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkll 82 
                     md d+ + rn+gyyep+  lk +lglql+s+i erd k     r+  + + + +aa+++rd          ++  rd ++++        ++kl+
  MELO3C005238P1   1 MDGDALNMRNWGYYEPS--LKAHLGLQLVSTIGERDVKHfmpgRDPSA-IVNMNAAFHPRDsvvseapvsTNW-ARDGWMNQ--------RDKLF 83 
                     99999988*******99..*******************9999766666.9***********888888886666.78888888........67888 PP

       GAGA_bind  83 alllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkk 177
                     ++l  ++s        ++ l +t+ ++ lq+     l+  + ++++ e   +l+ie +++++k +k++kkrq++  pk++k kk++k  +    k
  MELO3C005238P1  84 NVLSPNTS--------YSLLAETSAAQPLQM-----LQ--PLDTSRDE--MVLKIE-EPPVKKGTKQPKKRQNGGAPKSPKPKKPRK--P----K 154
                     88886765........88999******9999.....33..34433444..345554.4888999999******************99..2....3 PP

       GAGA_bind 178 vkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekL 272
                     ++ +s  +++ka+kk+++lv+ng ++D+s++P+PvCsCtG+++qCY+WG GGWqSaCCtt++S +PLP+s krrgaRiagrKmSqgafkk+LekL
  MELO3C005238P1 155 SNDPSF-QQVKAPKKKMELVINGFDMDISSIPIPVCSCTGTPHQCYRWGYGGWQSACCTTSLSLHPLPMSEKRRGARIAGRKMSQGAFKKVLEKL 248
                     344443.579************************************************************************************* PP

       GAGA_bind 273 aaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     aa+Gy++snp+DL++hWA+HGtnkfvtir
  MELO3C005238P1 249 AAQGYNFSNPIDLRSHWARHGTNKFVTIR 277
                     ****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.5E-1481277IPR010409GAGA-binding transcriptional activator
PfamPF062172.9E-1052277IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDGDALNMRN WGYYEPSLKA HLGLQLVSTI GERDVKHFMP GRDPSAIVNM NAAFHPRDSV  60
VSEAPVSTNW ARDGWMNQRD KLFNVLSPNT SYSLLAETSA AQPLQMLQPL DTSRDEMVLK  120
IEEPPVKKGT KQPKKRQNGG APKSPKPKKP RKPKSNDPSF QQVKAPKKKM ELVINGFDMD  180
ISSIPIPVCS CTGTPHQCYR WGYGGWQSAC CTTSLSLHPL PMSEKRRGAR IAGRKMSQGA  240
FKKVLEKLAA QGYNFSNPID LRSHWARHGT NKFVTIR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466895.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X1
RefseqXP_008466899.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2
RefseqXP_016898882.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2
SwissprotQ9SKD02e-92BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A1S3CS990.0A0A1S3CS99_CUCME; protein BASIC PENTACYSTEINE2-like isoform X1
TrEMBLA0A1S3CSF60.0A0A1S3CSF6_CUCME; protein BASIC PENTACYSTEINE2-like isoform X2
STRINGXP_008466895.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.34e-92basic pentacysteine 2