PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005009P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 205aa    MW: 22340.6 Da    PI: 6.8765
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005009P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-42371361100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll +lp+++r da+sslvyeA ar+rdPvyG++g i +lq+q+++l+aela
  MELO3C005009P1  37 PCAACKILRRRCAEKCVLAPYFPPSDPLKFTIAHRIFGASNIIKLLLDLPDSQRADAVSSLVYEASARIRDPVYGCAGAICQLQKQINELQAELA 131
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MELO3C005009P1 132 KTQAE 136
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.42636137IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4137134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MESREVKSSP TSTLLSQSPS PSPSPPPTVQ APVVVSPCAA CKILRRRCAE KCVLAPYFPP  60
SDPLKFTIAH RIFGASNIIK LLLDLPDSQR ADAVSSLVYE ASARIRDPVY GCAGAICQLQ  120
KQINELQAEL AKTQAELVNI HCHQTNLVAL ICKELAQTPP PMSSLSLLPD HRSLDNNFNI  180
ATPQSYQGYT SLFEDSNIWD PLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
GenBankLN6819280.0LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463550.11e-149PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-67LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0LS551e-107A0A0A0LS55_CUCSA; Uncharacterized protein
STRINGGLYMA13G40370.23e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-64LOB domain-containing protein 1