PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C004887P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25305.1 Da    PI: 8.4878
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C004887P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33.2e-192481457
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++t+eq+e+Le++++++++ps  +r++L + +    +++ +q+kvWFqNrR +ek+
  MELO3C004887P1 24 YVRYTTEQVEALERVYAECPKPSSLRRQQLVRDCpilaNIEPKQIKVWFQNRRCREKQ 81
                    6789****************************************************97 PP

2bZIP_120.11.4e-06751171860
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                     rr+R++ ++e  +L+    +L+a Nk L +e+++l+k+v++l 
  MELO3C004887P1  75 RRCREKQRKEASRLQSLNSKLTAMNKLLMEENDRLQKQVSQLV 117
                     9***************************************985 PP

3START29.81.4e-10165222259
                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHH CS
           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvla 59 
                     +aee ++++++ka+ ++  Wv+++ +++g++++ +f+ s+++sg a+ra+g+v  +++
  MELO3C004887P1 165 IAEEILAAFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCSGVAARACGLVGLEPM 222
                     789999***********************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-191078IPR009057Homeodomain-like
PROSITE profilePS5007115.4181882IPR001356Homeobox domain
SMARTSM003892.0E-152086IPR001356Homeobox domain
SuperFamilySSF466892.48E-172186IPR009057Homeodomain-like
CDDcd000863.81E-162383No hitNo description
PfamPF000469.8E-172481IPR001356Homeobox domain
CDDcd146863.85E-575114No hitNo description
Gene3DG3DSA:1.20.5.1709.6E-479116No hitNo description
PfamPF018522.4E-7165223IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MAMAHHRENG DGGINGHLDS TGKYVRYTTE QVEALERVYA ECPKPSSLRR QQLVRDCPIL  60
ANIEPKQIKV WFQNRRCREK QRKEASRLQS LNSKLTAMNK LLMEENDRLQ KQVSQLVCEN  120
GYMRQHLQTT NAPAATTTDA ACDSVATTPQ LSLRDASSPA GLLSIAEEIL AAFLSKATGT  180
AVDWVQMPGM KPGPDSVGIF AISQSCSGVA ARACGLVGLE PMKASMFILL I*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of interfascicular fiber (cortical cells) and secondary xylem differentiation in the inflorescence stems. Required for lateral shoot meristems (LSMs) and flower meristems (FMs) initiation. May be involved in the determination of vascular patterning and organ polarity (PubMed:10559440, PubMed:11169198, PubMed:11402186, PubMed:15111711, PubMed:15598805, PubMed:7555701). Directly regulates the expression of AGO10, ZPR1, ZPR2, ZPR3 and ZPR4 (PubMed:22781836). Required to regulate adaxial-abaxial polarity and leaf axial patterning (PubMed:20807212). {ECO:0000269|PubMed:10559440, ECO:0000269|PubMed:11169198, ECO:0000269|PubMed:11402186, ECO:0000269|PubMed:15111711, ECO:0000269|PubMed:15598805, ECO:0000269|PubMed:20807212, ECO:0000269|PubMed:22781836, ECO:0000269|PubMed:7555701}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. Repressed by ZPR and miR165. Induced by DOF5.1 (PubMed:20807212). {ECO:0000269|PubMed:15111711, ECO:0000269|PubMed:17237362, ECO:0000269|PubMed:20807212}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819281e-123LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132661e-123LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462593.11e-159PREDICTED: homeobox-leucine zipper protein REVOLUTA-like
SwissprotQ9SE431e-125REV_ARATH; Homeobox-leucine zipper protein REVOLUTA
TrEMBLA0A1S3CHC51e-158A0A1S3CHC5_CUCME; homeobox-leucine zipper protein REVOLUTA-like
STRINGXP_008462593.11e-159(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1957355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.11e-119HD-ZIP family protein
Publications ? help Back to Top
  1. Lian H,Li X,Liu Z,He Y
    HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis.
    J. Exp. Bot., 2013. 64(11): p. 3397-410
    [PMID:23918970]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Baima S, et al.
    Negative feedback regulation of auxin signaling by ATHB8/ACL5-BUD2 transcription module.
    Mol Plant, 2014. 7(6): p. 1006-1025
    [PMID:24777988]
  4. Jia X, et al.
    Functional plasticity of miR165/166 in plant development revealed by small tandem target mimic.
    Plant Sci., 2015. 233: p. 11-21
    [PMID:25711809]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Shi B, et al.
    Two-Step Regulation of a Meristematic Cell Population Acting in Shoot Branching in Arabidopsis.
    PLoS Genet., 2016. 12(7): p. e1006168
    [PMID:27398935]