PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003781P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 308aa    MW: 34469 Da    PI: 7.9349
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003781P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702203.75.2e-631042443154
          DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 
                      g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpaakrrerqqq +++ + + +s+++  +k +r +    q +l+    ++ +  
  MELO3C003781P1 104 GGGMNCQDCGNQAKKDCSHLRCRTCCKSRGFHCQTHVKSTWVPAAKRRERQQQRHQQLRAD-QSSDQTVPKIHRAN----QPSLT----PTIT-- 187
                     5789**********************************************99988754433.22333333333332....22222....2222.. PP

          DUF702  98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     + le  ++  e +s+avfrcv+vs++d+ ee+laYqtav+igGh+fkGiLydqG+e+
  MELO3C003781P1 188 SGLELGNFQGEFNSSAVFRCVKVSAIDNVEEQLAYQTAVNIGGHMFKGILYDQGPEN 244
                     3477889************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.0E-59106243IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.1E-27108150IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.8E-24195242IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTELFYLDRK QEDDPENQRT RSEQQLFLYN GRSNNPQQIY SKEFQIWPQY YSHNHHLPNQ  60
NVENYISFGV GPSRRSSLMI NAFDHDFVSR SGFTMTRHSG GGGGGGMNCQ DCGNQAKKDC  120
SHLRCRTCCK SRGFHCQTHV KSTWVPAAKR RERQQQRHQQ LRADQSSDQT VPKIHRANQP  180
SLTPTITSGL ELGNFQGEFN SSAVFRCVKV SAIDNVEEQL AYQTAVNIGG HMFKGILYDQ  240
GPENNQINLS SGGDGENDGQ GLDLVIGASN CSGRVNNQST PFVESSLYPI PINSFNNCTQ  300
FFPSSRT*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator involved in the transcriptional regulation of terpene biosynthesis in glandular trichomes (PubMed:24884371, PubMed:24142382). Binds to the promoter of the linalool synthase TPS5 and promotes TPS5 gene transactivation (PubMed:24884371, PubMed:24142382). Acts synergistically with MYC1 in the transactivation of TPS5 (PubMed:24884371). {ECO:0000269|PubMed:24142382, ECO:0000269|PubMed:24884371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466512.10.0PREDICTED: protein SHI RELATED SEQUENCE 3
SwissprotK4B6C93e-65EOT1_SOLLC; Protein EXPRESSION OF TERPENOIDS 1
TrEMBLA0A1S3CRF20.0A0A1S3CRF2_CUCME; protein SHI RELATED SEQUENCE 3
STRINGXP_008466512.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.13e-58Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Spyropoulou EA,Haring MA,Schuurink RC
    RNA sequencing on Solanum lycopersicum trichomes identifies transcription factors that activate terpene synthase promoters.
    BMC Genomics, 2014. 15: p. 402
    [PMID:24884371]