PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003554P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 219aa    MW: 25281.3 Da    PI: 7.5941
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003554P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.1e-1863115456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++++ +q++ Le++Fe ++++  +++ ++A++l+L+ rqV++WFqNrRa++k
  MELO3C003554P1  63 KRRLKLDQVKGLERHFEVENKLEPDRKMKIAAELELEPRQVTIWFQNRRARWK 115
                     4478889*********************************************9 PP

2HD-ZIP_I/II119.71.5e-3861153193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     e+krrl+ +qvk LE++Fe e+kLep+rK+++a eL+l+prqv +WFqnrRAR+ktkqlEkdy +Lk +ydalk + + Leke+++L++++ke
  MELO3C003554P1  61 ERKRRLKLDQVKGLERHFEVENKLEPDRKMKIAAELELEPRQVTIWFQNRRARWKTKQLEKDYGVLKLNYDALKLDYDVLEKENASLASKVKE 153
                     69***************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1945118IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1849119IPR009057Homeodomain-like
PROSITE profilePS5007116.14757117IPR001356Homeobox domain
SMARTSM003894.3E-1660121IPR001356Homeobox domain
CDDcd000863.86E-1362118No hitNo description
PfamPF000462.6E-1563115IPR001356Homeobox domain
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PfamPF021832.0E-15117158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MKRFSHSDSL DSFISFFSPK DQQPNSKAIG GYSKEFQAML DSLEEEDNSE DGGSSGGSAP  60
ERKRRLKLDQ VKGLERHFEV ENKLEPDRKM KIAAELELEP RQVTIWFQNR RARWKTKQLE  120
KDYGVLKLNY DALKLDYDVL EKENASLASK VKELREKVNR AMKKGSMERD DSNRDGNNSY  180
ISMLKNNNNQ IQFTKAMNED QSLVNFCSVD QAPSLHYW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16065ERKRRL
2109117RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466655.11e-161PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotP466676e-46ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLA0A1S3CRT31e-159A0A1S3CRT3_CUCME; homeobox-leucine zipper protein ATHB-6-like
STRINGXP_008466655.11e-160(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.12e-42homeobox protein 5
Publications ? help Back to Top
  1. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  4. Stamm P, et al.
    The Transcription Factor ATHB5 Affects GA-Mediated Plasticity in Hypocotyl Cell Growth during Seed Germination.
    Plant Physiol., 2017. 173(1): p. 907-917
    [PMID:27872245]