PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003433P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 736aa    MW: 81972.2 Da    PI: 6.4026
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003433P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.6e-201873156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t+ q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  MELO3C003433P1 18 KKRYHRHTARQIQEMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 73
                    688899***********************************************998 PP

2START157.51e-492204453206
                     HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
           START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..............dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                     a +  +elvk+  ++ep+Wv++   e g+e l  +e ++               +++ea r+s+vv+m++ +lv  +ld + +W e ++    ka
  MELO3C003433P1 220 AVSSIAELVKMCRLTEPLWVRDN--ESGKEILNVEEHGRMfpwplnlkqhlineFRTEATRDSAVVIMNSITLVDAFLDAN-KWMELFPsivaKA 311
                     677889***************99..99999999998888899***************************************.******99999** PP

                     EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
           START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                     +t++viss       + lqlm+aelq lsplvp R+  f+R+++q   +g+w++vd  +ds  +   ++s+ R ++ pSg++i++++ng+s+vtw
  MELO3C003433P1 312 KTVQVISSSvsghatSSLQLMYAELQTLSPLVPtREAHFLRCCQQnADEGSWTVVDFPIDSFHDSL-QHSFPRYRRKPSGCIIQDMPNGYSRVTW 405
                     *********************************************9999*************9987.9*************************** PP

                     EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     veh++ +++ +h+++ ++v+sg+a+ga +w+a lqrqce+
  MELO3C003433P1 406 VEHAEIEEKPIHQIFDHFVHSGMAFGAHRWLAILQRQCER 445
                     **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-181076IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-201380IPR009057Homeodomain-like
PROSITE profilePS5007117.3941575IPR001356Homeobox domain
SMARTSM003896.0E-191679IPR001356Homeobox domain
CDDcd000863.83E-181876No hitNo description
PfamPF000467.7E-181873IPR001356Homeobox domain
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084844.623209448IPR002913START domain
SuperFamilySSF559613.43E-31211447No hitNo description
CDDcd088752.03E-115213444No hitNo description
SMARTSM002347.0E-36218445IPR002913START domain
PfamPF018521.9E-42220445IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-6301428IPR023393START-like domain
SuperFamilySSF559612.75E-16482700No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MESNINNNDN ITQQNQKKKR YHRHTARQIQ EMEALFKECP HPDDKQRLKL SQELGLKPRQ  60
VKFWFQNRRT QMKAQQDRSD NVILRAENET LKNENYRLQS ALRNIICPSC GGQGILGEPS  120
LDEQQLRLEN ARLRDQLEQV CSMTTRYTGR PIQAMASTAP PLMQPSLDLD MNIYSRQYTE  180
AMVPSSEMMA LPSMLPPEAA HFPEGGLLIE EEKTLAMDLA VSSIAELVKM CRLTEPLWVR  240
DNESGKEILN VEEHGRMFPW PLNLKQHLIN EFRTEATRDS AVVIMNSITL VDAFLDANKW  300
MELFPSIVAK AKTVQVISSS VSGHATSSLQ LMYAELQTLS PLVPTREAHF LRCCQQNADE  360
GSWTVVDFPI DSFHDSLQHS FPRYRRKPSG CIIQDMPNGY SRVTWVEHAE IEEKPIHQIF  420
DHFVHSGMAF GAHRWLAILQ RQCERIASLM ARNISDLGVI PSPEARQNLM KLAQRMIRTF  480
SVNISTSGGQ SWTALSDSPE DTVRITTRKV VEPGQPNGVI LSAVSTTWLP YPHYRVFDLL  540
RDERRRSQLE VLSNGNSLHE VAHIANGSHP GNCISLLRIN VASNSSQHVE LMLQESCTDQ  600
SGSLVVYATI DVDSIQLAMS GEDPSCIPLL PIGFSIVPIL GSTVDGHPAP PPDDGTPNAN  660
SGCLLTVGLQ VLASTIPSAK LNLSSVTAIN NHLCNTVHQI NIALGGPGRL ENDNNVVAEP  720
NNPPTPPPPP PPSKQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466007.10.0PREDICTED: homeobox-leucine zipper protein HDG5
RefseqXP_008466008.10.0PREDICTED: homeobox-leucine zipper protein HDG5
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A1S3CQ810.0A0A1S3CQ81_CUCME; homeobox-leucine zipper protein HDG5
STRINGXP_008466007.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109463036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7