PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002897P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 1396aa    MW: 153152 Da    PI: 7.8285
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002897P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53.2e-089611001345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT  E  l+++av  +G++ ++ I+ ++g  ++  qck ++ 
   MELO3C002897P1  961 YWTDGEKSLFIEAVSVYGKN-FSVISTHVG-SKSTDQCKVFFS 1001
                       5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-14735795IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-4743793IPR009057Homeodomain-like
PROSITE profilePS5129315.336747798IPR017884SANT domain
SMARTSM007173.0E-5748796IPR001005SANT/Myb domain
PROSITE profilePS5129312.419571008IPR017884SANT domain
SMARTSM007171.1E-69581006IPR001005SANT/Myb domain
SuperFamilySSF466897.1E-119591008IPR009057Homeodomain-like
PfamPF002491.2E-69611001IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-59621002IPR009057Homeodomain-like
CDDcd001672.79E-59621000No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1396 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSEFLGPLPR WRDSSSHGSR EFSRWGSGDF RRPPGHGRQG  60
GWHVFSEEYG HGYGPSMSFN NKMLENVSSR PSVSHGDGKY ARNGRESRSF SQRDWKGHSW  120
ATSNGSTNNG GRIQHDLNYD QRSVHDMLIY PSHSHSDFVN PRDKVKGQHD KVDDVNGLGT  180
NQRRDREYSV SSSGWKPLKW TRSGGLSSRT STSGHSSSKK SVDALDSNDR KSETVSKNAS  240
QNFSPSADHA ECAMSSLPYD DASARKKPRL GWGEGLAKYE KKKVEVPDGS TAFTNVNAES  300
THSLNSCLIE KGPRGSGFAD CTSPATPSSV ISGSSPGGDE KSFGKASSDN DVSNFHGSPG  360
SGFQNQYEGT STVEKLDNFS IANLCSPLIQ LLQSNDSTSV DSTALSKLLI YKNQISKVLE  420
TTESEIDLLE NELKGLKSEG KGYFSFTLAS SPLVGDKFFE EQNNVTNTVA TLPVVTSAHT  480
ISKTLAHSTN DLEEVYADKD RSGRSDVKES VMKENLTVSG CSAKDHIVAY IDNSLPIKSE  540
GVTVHPVAND TYECAEGGDS VSDLILASNK ESACKASEAL MRMLPTNECK IDIWSTNACA  600
QNQCLVKERF AKRKRLLRFK ERVITLKFKA YQSLWKENLH VPPVRKLRAK SQKKHQLSLW  660
TNYSGYQKNR SSIRYRMPSP AGNLNPVSST EILKHVSMQL SSPQIKQYRR TLKMPTLVLD  720
QKDKMGSRFI SNNGLVENPC AVEKERAMIN PWTSEEKDVF MEKLECFGKD FGKIASFLDH  780
KTTADCVEFY YKNHKSDCFE KTKKLEFGKK VKSSTSNYLM TTGKKWNPET NAASLDILGA  840
ASTMTARAHK YSSGRSGGRT SYHTTQFDDD LSERAKGLNS FGNEREKVAA DVLAGICGSL  900
SSEAMGSCVT SNFNRGDSSQ DLKCKKGATT VLRRRMTTNV PRYVDNEIFS DESCGEMGPS  960
YWTDGEKSLF IEAVSVYGKN FSVISTHVGS KSTDQCKVFF SKARKCLGLD LICSAKKMPD  1020
NGNGHDADGG NGEGGVDTKD AFPCELVGSR VVDDLPKSVM SISGGESESM NLQSTHQEVK  1080
ESNLSSKTCS NAAVDAMVSD DECTRKDGSQ SGFDEDCQSV NSANDKNGLV NEQQHAVMSN  1140
ETAKEQDISV SVATSVENVS DTETKRGNVD ASTARGDKAD SHAADCPSMP LNSHITSSAK  1200
EEQGRHHIRV HSRSLSDSER SSRNGDIKLF GQILTHSSFV PSSKSGSSEN GIRTTEPHHK  1260
FKRRLKVNSH GNLSTAKFDC KNSPGQEEST PSRSYGIWDG NQIRTGLSSL PDPTTLLTRY  1320
PTFNHLSKPA FSPIEQQSLS SCKEEKSNSN EETQKMEVNN SRKEEVVGGM NVGESCNDGC  1380
DIKLDCSNKG GGSGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-15709800494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-15709800494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
GenBankLN6818920.0LN681892.1 Cucumis melo genomic scaffold, anchoredscaffold01595.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465673.10.0PREDICTED: uncharacterized protein LOC103503311 isoform X1
TrEMBLA0A0A0KU040.0A0A0A0KU04_CUCSA; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-122MYB family protein