PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002290P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 168aa    MW: 18814.3 Da    PI: 8.3613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002290P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.4e-44131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv kll+++ +++r+da+ sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  MELO3C002290P1  13 PCAACKFLRRKCLAGCVFAPYFPPEEPQKFANVHKVFGASNVAKLLNEVLPHQRQDAVVSLAYEAEARIRDPVYGCVGAISFLQKQVQRLQKELD 107
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k++
  MELO3C002290P1 108 AAKAR 112
                     99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.18205.4E-42142IPR029058Alpha/Beta hydrolase fold
PROSITE profilePS5089126.79512113IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGSTTTGNHY YSPCAACKFL RRKCLAGCVF APYFPPEEPQ KFANVHKVFG ASNVAKLLNE  60
VLPHQRQDAV VSLAYEAEAR IRDPVYGCVG AISFLQKQVQ RLQKELDAAK ARLFLYSCTD  120
FSTPFLPQYP QIINTPHHPL IWNSNYSNNN NNHDDINNPS MYFNGGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318660.18e-68hypothetical protein POPTR_0012s08540g
RefseqXP_003527004.17e-68PREDICTED: LOB domain-containing protein 25-like
RefseqXP_006581908.17e-68PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML46e-64LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0A0LTL01e-104A0A0A0LTL0_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s08540.13e-67(Populus trichocarpa)
STRINGGLYMA06G18861.13e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2447133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-65LBD family protein