PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002209P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 334aa    MW: 37254 Da    PI: 4.4126
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002209P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1999152356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  MELO3C002209P2  99 KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 152
                     56689************************************************9 PP

2HD-ZIP_I/II130.28.4e-4298188191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekkrrl+ +qv++LE+sFe+e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEkdyeaL+++y +lk + e+L ke+++L++e+
  MELO3C002209P2  98 EKKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYEALQSSYGSLKVDYENLLKEKDSLKAEI 188
                     69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.37E-1984156IPR009057Homeodomain-like
PROSITE profilePS5007117.26594154IPR001356Homeobox domain
SMARTSM003893.2E-1997158IPR001356Homeobox domain
CDDcd000863.25E-1899155No hitNo description
PfamPF000461.4E-1699152IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-19101161IPR009057Homeodomain-like
PRINTSPR000319.6E-6125134IPR000047Helix-turn-helix motif
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PRINTSPR000319.6E-6134150IPR000047Helix-turn-helix motif
PfamPF021832.8E-14154195IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAGRRVYGGD DGGSISGGSS NHSVLLQNCG GSFASEPLNA LFLSGSSSSS SPSLLGSRSM  60
MSFEDIRGGN GSNRSFFCPL DSEDNGDEDL DDYFHHPEKK RRLTVDQVRF LEKSFETENK  120
LEPERKVQLA KDLGLQPRQV AIWFQNRRAR WKTKQLEKDY EALQSSYGSL KVDYENLLKE  180
KDSLKAEILL LTDKLLHKEK ERGNSVLSEV DKFGEELPHN LVADSNLEDE VSKSSKLGCK  240
QEDISSVKSD LCDSDSPHYT DGVHSSLLEP GDSSYIFDPD QSDLSQDEED NLGRNLLPPY  300
IFPKLEDVDY SDPPTSSCNF VFPIEDNALW SWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437631.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X2
TrEMBLA0A1S3AV260.0A0A1S3AV26_CUCME; homeobox-leucine zipper protein HAT5-like isoform X2
STRINGXP_008437622.10.0(Cucumis melo)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-44homeobox 1